(data stored in ACNUC7421 zone)

EMBL: AP011115.PE276

AP011115.PE276       Location/Qualifiers
FT   CDS_pept        295445..295885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48523"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR46"
FT                   /protein_id="BAH48523.1"
FT                   /translation="MAHVQRFDHIGITVADLDSATAFFVGLGLEVEGTGSVEGEFVETV
FT                   CGIPGAHCEIAMLRPPGGGSRLELSAFVTPDHVPGSPTAMANELGLRNVSFEVRDLQAA
FT                   VDAVAADGYGLIGGIGEYENSVRMAYVRGPEGIIVSLFEQIG"
     atggcacacg tacaacgttt cgaccacatc ggtatcaccg tcgccgacct cgactcggca        60
     acggcgttct tcgtcgggct gggcctcgag gtcgagggca ccggatccgt ggagggcgag       120
     ttcgtggaga ccgtctgcgg tatccccggc gcgcactgcg agatcgcaat gctgcggccg       180
     cccggcggag ggtcccggct ggagctctcg gccttcgtca cccccgacca cgtgcctgga       240
     tcgccaaccg cgatggccaa cgagctcggg ctgcgcaacg tgtccttcga ggtccgcgac       300
     ctccaggcgg ccgtcgacgc ggtggctgcg gacgggtacg ggctcatcgg cggcatcggc       360
     gagtacgaga acagcgtgcg gatggcctac gtgcgcgggc ccgaagggat catcgtgtcc       420
     ctgttcgagc agatcggctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page