(data stored in ACNUC7421 zone)

EMBL: AP011115.PE277

AP011115.PE277       Location/Qualifiers
FT   CDS_pept        complement(296134..297174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48524"
FT                   /db_xref="GOA:C1AR47"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR47"
FT                   /protein_id="BAH48524.1"
FT                   /translation="MDPSAAPAVKVTHGAPAVMDTAPVMLTKRTCFSAISMVILAVAGL
FT                   LVATPGNSAAAPPAWRYTMVAFSNTSDRDMDVYESGDGTGFQPVGLSAFRPPSGLVRDP
FT                   SIFRNADGLYYLTYTTGGGANIGFARSSDRINWTPLGNYPVPFCCALMPGTGDGTGSAS
FT                   PPGFSGSAGFRDGPSLSPFVTKAWAPEWFVDGDRVNVILSLSTGGGFVPYLMTALEPSL
FT                   RLWSPPVPLAGIGADHIDTTVVKVGATYHAFTKNETKKVVEHAVASSVTGPYSFVPAGN
FT                   WGSLVEGPALAQLPNGAWRIYLDAYTEGKYLYSDSTDGLRTWSPVQELPGLSGTARHFG
FT                   VMTEPA"
     ttggatccgt ccgcggcgcc tgcggtgaaa gttacgcatg gtgcgcctgc tgtcatggat        60
     actgcaccgg tgatgctgac caaacgaacc tgcttttcgg ccatatcgat ggtgatcctc       120
     gctgtcgcgg gcctgctggt cgcgaccccg gggaacagcg ccgccgcacc gcccgcctgg       180
     cgatacacga tggtggcgtt cagcaacacc agcgaccgcg acatggatgt atacgagtcg       240
     ggggacggca cggggttcca acccgtcgga ctgtcggcgt ttcggccccc gtcagggctt       300
     gtgcgtgacc cgagcatctt ccggaacgca gacgggttgt attacctcac ctacaccaca       360
     ggcggtgggg cgaacatcgg cttcgcacgc agtagtgacc gcatcaactg gacacccctg       420
     gggaactatc cggtcccgtt ttgctgcgcc ttgatgccgg gcacggggga tggcacaggt       480
     tctgcgagcc cgccgggctt ctcggggtcg gccgggttcc gggacggacc gtcgctgtcg       540
     ccattcgtca ccaaagcctg ggcgcccgaa tggttcgtgg acggcgaccg cgtcaacgtc       600
     atcctgtcgc tgtcgaccgg tggaggattc gtgccgtatc tgatgacggc gctggaaccc       660
     tcgctcaggt tgtggagccc gcctgttccg ctcgccggga tcggcgcgga ccacatcgac       720
     accaccgtgg tcaaggtggg agcgacctat catgcgttta ccaagaacga gacgaagaag       780
     gtcgtcgagc atgcggtcgc gtcgtcggtg acgggaccct attcattcgt ccccgctgga       840
     aattggggct cgctggtgga gggcccagcc ctggctcagt tgccgaacgg cgcctggcgg       900
     atatatctcg acgcctacac cgaaggaaag tatctctatt ccgacagcac ggacggtctg       960
     cgcacctggt cgcccgtgca ggagcttccg ggcctttccg ggacggcgcg ccatttcggc      1020
     gtgatgacag agccggcgta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page