(data stored in ACNUC7421 zone)

EMBL: AP011115.PE278

AP011115.PE278       Location/Qualifiers
FT   CDS_pept        complement(297356..298519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02780"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48525"
FT                   /db_xref="GOA:C1AR48"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR48"
FT                   /protein_id="BAH48525.1"
FT                   /translation="MRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQLVL
FT                   GFLLCLPIAWRRKYPRAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVSLYTLVAY
FT                   VDRRTAAVYAVGLVVDSALSIWLLEQELLAAGLFSVLVFALSWITAEFLGARRAYDEEV
FT                   AARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALTSNPDIA
FT                   KQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVELE
FT                   LTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGNSS
FT                   GQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
     atgaggaggt tcagtctgtg gctgcggggt aagccgacgg ttgcggactc gatgttggcg        60
     gcgatcctgt tcaccctcga ggtgttcgtg ttcaccgcgt cgggagatcg ctcgccgtgg       120
     gtgcagctgg tcctgggttt cctcctgtgc ctgccgatcg cgtggcgccg caagtatcca       180
     cgggcggcgg caggcgccgt gctggtgatg tcgatcacga tcaccttcat cagctattcc       240
     atcggcgacc tcgacgccga gcaccccggt ctgctggcgc tcgccgtctc cctctacacg       300
     ctcgtcgcct acgtcgaccg ccgcaccgcc gcggtgtacg cggtgggcct cgtcgtcgat       360
     tcggccctgt cgatctggct gctggagcag gaactgctgg cggccggatt gttctcggtg       420
     ctcgtcttcg cgctgtcctg gatcaccgcg gagttcctcg gagcccgccg cgcctacgac       480
     gaggaggtcg cggctcggct cgtcgtcgcc gactacgacc gggatcgccg cgccgaggac       540
     gcggtggccg ccgagcggac ccggatcgcc cgggaactgc acgacgtggt cgcgcacgcg       600
     gtgagcgtga tgatcgtgca ggccgacggt gcgtcctacg ccctgacgag caaccccgac       660
     atcgcaaaac aggcactgac caacatcgcg agcaccgggc gggaggcgct ggcggaactg       720
     cggcgcaccg tgtcgctgct ccgcaccgaa ccggcgaccg acgacatgcc ccagcacggc       780
     acggccgggc tcgcccgggt ggtcgacatg atgcgcagcg ccggcctgcc cgtggaactg       840
     gagttgacgg gcgagttgga cgacatcagc ccggccgtca gcctcggcgt acaccggctg       900
     gttcaggaat cgctgacgaa cgtgctccgg cacgccggag aacgcccgcg cgccaaggtg       960
     cgggtgcggc gccgcgagac ggacgtcctc gtcgagatca ccgacaacgg caactcctcc      1020
     ggacaattct cgctcggctc cggcaacggg ctgctgggga tgcgggagcg ggtcgccgtc      1080
     ctgcacggca cgctcgaggc gggacggcag accgacggga gttggcgggt caccgccgag      1140
     ttgccgctcg agttggagga ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page