(data stored in ACNUC7421 zone)

EMBL: AP011115.PE279

AP011115.PE279       Location/Qualifiers
FT   CDS_pept        298566..299333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48526"
FT                   /db_xref="GOA:C1AR49"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR49"
FT                   /protein_id="BAH48526.1"
FT                   /translation="MNAGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLSMAVCNVIGAVTG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
     atgaatgcgg gtgactgggc gctacttctg accgccgcga cggccgccgg ctgggtggac        60
     gccgtcgtcg gcggtggcgg gctgatcctc attcccgcac tgtttctcgt cgcaccgcag       120
     ctgacgccgc aggcggcgct ggccacgaac aagctcaccg cgttcaccgg cacgtccgct       180
     gccgtcgtca cgttcgcgcg ccgcatcccc atgaactggc ggttgctggt tcccgcaggc       240
     ctgctcgccg cggtggcgtc cgcgctcggc gccgcgacgg tgtcgcgcat cgacaaggac       300
     gtgttcatcc cgctcatcat ggcggtgctc gtcggggtcg ccgtgttcgt gaccatccgt       360
     ccgcaactcg ggaccacgct ggcgaaggat ccgccgaccc ggcggaaggt cgtcgccgtc       420
     gtcctgctct ccgccgggct cctcggtttc tacgacggct tgttcgggcc gggcaccgga       480
     accttcctca tcatcagctt cgccacgttc ctcggtacgg aattcgtgcg cagcgccgcg       540
     atggcgaagg tgatcaatct cggatcgaat ctcggtgccc tggtgttctt cgccgccacc       600
     ggacacgtgc tgtgggcgct cggcctgagc atggcggtct gcaacgtgat cggagcggtc       660
     accggttcgc ggatggccct gagcaagggt gccggtttcg tccggatcac cctgctgatc       720
     gtggtgatcg cgatggtgat ccggttgggt tggcagcaat tcgggtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page