(data stored in ACNUC7421 zone)

EMBL: AP011115.PE28

AP011115.PE28        Location/Qualifiers
FT   CDS_pept        complement(24162..24527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00280"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48275"
FT                   /db_xref="GOA:C1AS26"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS26"
FT                   /protein_id="BAH48275.1"
FT                   /translation="MVMLWIACAGSAGAIARFVIDGAIKHRKASEFPWATATINVTGSL
FT                   LLGFVTGLILFHGVPREIQLIVGVGFCGGYTTFSTASFETVRLIQRQKYAAGIANAVGT
FT                   LTVTVIAGGAGLALASV"
     atggtgatgt tgtggatcgc ctgcgcaggc agtgccgggg cgatcgcccg gttcgtgatc        60
     gacggggcga tcaaacaccg gaaggcgtcg gaattcccct gggcgacggc gacgatcaac       120
     gtgaccgggt cgctgctcct cgggttcgtc accggcctga tcctcttcca cggtgttccg       180
     cgggaaattc agctgattgt gggtgtgggc ttctgcggcg ggtacaccac cttcagcacc       240
     gcgagtttcg agaccgtgcg gctgattcaa cgccagaaat acgccgccgg gatcgcgaac       300
     gcggtcggca ccctgacggt gactgtcatc gccggcggtg ccggtctcgc tctggcttcg       360
     gtgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page