(data stored in ACNUC7421 zone)

EMBL: AP011115.PE280

AP011115.PE280       Location/Qualifiers
FT   CDS_pept        299356..300876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02800"
FT                   /product="TldD/PmbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48527"
FT                   /db_xref="GOA:C1AR50"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR50"
FT                   /protein_id="BAH48527.1"
FT                   /translation="MTAPRQVDPEFLALPLRSLADAALTAARAAGASHADLRVHRLASQ
FT                   SLRLRDGEVQSAVDTDELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARALRG
FT                   LNREHVELADEPVYSDVHWVSDYDLDPFEVAASEKISLLGEYSRRLLASDGVDHVTAGC
FT                   LQVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWEYVAG
FT                   DGVWNWTDELTRIPDLLAEKVKAPSVVAGPTDLVIDPTNLWLTIHESIGHATEYDRAIG
FT                   YEAAYAGTSFATPDKLGTLRYGTPIMRVTADRTERHGLATVGYDDDGVETQSWDLVADG
FT                   ILVGYQLDRAFAPRLGLARSNGCSYADSPHHVPIQRMANVSLQPDPDTDRSTDDLISGV
FT                   EDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGRLDGQLRDVAYQATTTDFWGSMDAV
FT                   GGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
     gtgacggctc cacgacaggt tgatccggaa ttccttgccc ttccgctgcg ttcgctggcg        60
     gacgcggcgc tcaccgccgc ccgagcggcg ggtgcgtcgc acgccgacct gcgggtacac       120
     cgactggcca gccaatcgct gcggctccgc gacggcgaag tgcaatcggc ggtggacacg       180
     gacgaactcg gcttcgcggt gcgggtcgtc gtcgacggca cgtggggttt cgcctcgcac       240
     gccgaactga cccccgccac ggccgccgcc actgcggaac aggccgtcgc cgtcgcccgc       300
     gcgctgcgcg ggctgaaccg ggaacacgtc gaactcgcgg acgaaccggt gtactcggac       360
     gtgcactggg tgtccgacta cgatctcgat ccgttcgaag tcgccgcctc tgagaagatc       420
     tcgctgctcg gcgaatactc ccgccgcctc ctcgcgtccg acggcgtcga ccacgtcacc       480
     gccggatgcc tgcaggtgaa ggaacagacg ttctatgccg atctcgccgg gtcgtccatc       540
     gtgcagcagc gggtgcggtt gcatccgcaa ctcgaagcga ccaccgtcga ccagtcggcc       600
     ggcgtgttcg agacgatgcg caccctcgct cccccggtcg gccggggatg ggaatacgtc       660
     gccggagacg gggtctggaa ctggaccgac gaactcaccc gcatcccgga cctgctcgcc       720
     gagaaggtga aggcccccag cgtggtggcc ggccccaccg atctggtgat cgacccgacc       780
     aacctatggc tgacgatcca cgaatccatc gggcacgcca ctgagtacga ccgcgcgatc       840
     ggctacgagg ccgcctacgc cggcacgtcg ttcgccacgc ccgacaagct cggcacactg       900
     cggtacggga caccgatcat gcgtgtgacc gccgaccgga ccgagcggca cggcctcgcg       960
     acggtcgggt acgacgacga tggcgtcgaa acacagtcct gggatctggt ggccgacggg      1020
     attctcgtcg ggtatcaact cgaccgggcg ttcgcgcccc ggctcgggct ggcgcgttcc      1080
     aacggctgct cgtacgccga ctcgccgcac cacgtcccca tccagcggat ggccaacgtg      1140
     tcgttgcagc ccgatcccga caccgatcgc agcaccgacg acctgatctc cggcgtggag      1200
     gacggcatct acgtggtcgg cgacaagtcc tggtcgatcg acatgcagcg ctacaacttc      1260
     cagttcaccg gtcagcggtt ctaccgcatc cgcggcggca gactcgacgg gcaactccgc      1320
     gacgtcgcct atcaggcgac cactaccgac ttctggggtt cgatggacgc cgtcggcggc      1380
     cggtccacct ggcagctggg cggcgcgttc aactgcggca aggcgcagcc cggccaggtc      1440
     gcggccgtca gccacggttg cccgtcggcg ctcttccgcg gcgtcaacgt actgaacact      1500
     cggacggaag gcggccgatg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page