(data stored in ACNUC7421 zone)

EMBL: AP011115.PE281

AP011115.PE281       Location/Qualifiers
FT   CDS_pept        300873..302234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48528"
FT                   /db_xref="GOA:C1AR51"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR51"
FT                   /protein_id="BAH48528.1"
FT                   /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGVS
FT                   TSRSWTVISIVRSGQDAKVGIVTSASVDAADIDGVVRSAEISARAATPASDAMPLLTGT
FT                   GTDERWEDSAQRTEIGAFEQLAQDLSMGFDGDDQLYGFAHHQLHTTWLGTSTGIRRRFV
FT                   QPTGSVEINGKRGDASAWVGTSTKDFTDVAGVKLLQDLSTRLDWAGNRVELPAGRYETI
FT                   LPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLSLYSDPAALGLEY
FT                   APFVIAGASSESVSVFDNGMDAGRVDWIRDGTVGALAYPRSAAKEFGAEATVPGDNLIL
FT                   DAGGSVSLDQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGKVTGAVNN
FT                   FRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPSVRVPDFHMSSVSKAL"
     atgatcgcac cgcagcaact cgtcgagcag gtcctcgccc gggccaccgt ggacgagacc        60
     atcgtgatcg tcaccgatgc cagcgaggcg tcgctgcggt gggcgggcaa ctcgatgacc       120
     accaacggcg tgtccacctc gcgcagttgg acggtgatct cgatcgtccg gtccgggcag       180
     gacgcgaagg tcggcatcgt gacgtcggcg agtgtcgacg ccgccgacat cgacggggtg       240
     gtccgttcgg ccgaaatctc ggcccgcgca gccacacccg cctccgacgc gatgccgctg       300
     ctcaccggaa ccggcaccga cgaacgctgg gaggattcgg cgcagcgcac cgagatcggc       360
     gcgttcgaac aactcgccca ggatctgagc atgggtttcg acggcgacga ccagctctac       420
     ggctttgccc accatcagct gcacaccacg tggctgggca cgtcgacggg gatccggcgc       480
     cgattcgtcc agccgaccgg gtcggtcgag atcaacggca aacgcggcga cgccagcgcc       540
     tgggtgggca ccagcaccaa ggacttcacc gatgtggcag gcgtgaagtt gctgcaggac       600
     ctgtcgacgc gcctggactg ggccggtaac cgcgtggagt tgcccgcggg ccggtacgag       660
     acgatcctgc cgccgtccgc ggtcgcggac ctcatgatct acctcatgtg gaccatggag       720
     ggcagggccg cggaagaggg acattccgcc ctgtcggcac ccggcgggac ccgcatcggg       780
     gaaaagctca gcgcgctacc cctcagcctc tattccgatc ccgccgcgct cggcctggag       840
     tacgcgccgt tcgtgatcgc cggggcgtcg tccgaatcgg tgtccgtctt cgacaacggg       900
     atggacgcgg gccgggtcga ctggatccgg gacggcaccg tcggtgcgct cgcgtacccg       960
     cggtcggcgg cgaaggagtt cggcgcggag gcgaccgtgc ccggcgacaa cctgatcctc      1020
     gacgccggcg gttcggtgtc gctcgaccag atggtggccg agaccgaacg cggactactg      1080
     ctgaccaccc tctggtacat ccgggaggtc gaccccgcca cgctgctgct cacgggattg      1140
     acgcgggacg gcgtctacct cgtcgaaaac gggaaggtca cgggtgccgt gaacaacttc      1200
     cgattcaacg agagcccgct cgacctgctg cggagggtca cgcaggccgg cgccaccgaa      1260
     cggaccctgc cccgcgagtg gaaggactgg ttcacccgga ccgcgatgcc gtcggtgcgg      1320
     gtgccggact tccacatgtc ttcggtcagc aaggcgctct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page