(data stored in ACNUC7421 zone)

EMBL: AP011115.PE283

AP011115.PE283       Location/Qualifiers
FT   CDS_pept        302657..303004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48530"
FT                   /db_xref="GOA:C1AR53"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR53"
FT                   /protein_id="BAH48530.1"
FT                   /translation="MTAPSTQRSTTIQEITVSNDVLEAAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFDELLDVSRHHHVSVLRAAKSLVELATRRQTCPSVTTPAPSYAL
FT                   EFTEWTTLLAR"
     atgaccgcgc cgagcactca gcgaagtacc acaatccagg agatcacagt gtcgaacgac        60
     gtactcgagg cagcaccgcc tgcacattcg attccgcacc gccaccccga cggacgcgag       120
     gtgctcgcca ccgcgaaagg catcctcatc gccacccgtg ggtacggcga cgccgaggca       180
     ttcgatgagc tgctcgacgt ctcgcgccat caccacgtca gcgtgttgcg ggcggcgaag       240
     tcgttggtgg aattggcgac tcggcgtcag acgtgcccat ccgtgacgac accggcaccg       300
     tcgtacgctc tcgagttcac ggaatggacg acgctgctgg cgcggtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page