(data stored in ACNUC7421 zone)

EMBL: AP011115.PE284

AP011115.PE284       Location/Qualifiers
FT   CDS_pept        complement(302973..304160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48531"
FT                   /db_xref="GOA:C1AR54"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR54"
FT                   /protein_id="BAH48531.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGKATGGWAPVQVVLQQFAQGKFLGLLTVMFGIGLVIQQRSAERRGQRWPGGYPWRAAL
FT                   LMLDGALHFLLFTEFDVLTGYALTGLIVAFILTAGIRAQRTWIVCAVAVHAAMLALLVA
FT                   ALYSAPAREPQPLSPNPYADGSFWDLIVFRADNVLLFRLEVLFILPLSIALFLVGARLY
FT                   GARVLDPDRGVLRRRLMVAGLAIALPLDLALGLFGGDAGLILGRYGTAPIVALGLLAAI
FT                   AHRYADGRAPGAPGRALSGVGRAALSCYVLQNILCSIVCYGWGFGLAARLDGTTVVPAT
FT                   IALFGAVSATLIVVSRLWLRRFDRGPLEWLTHRAYQRLTRADRDGVTAPAASSIP"
     atgacgtcgc aactgtcgag ttcccaccgc tacgccgcgc tcgacgtcat gcgcggtgca        60
     gccatcttgg gcactctcgc caccaacatc tggatcttca ccaacgtcga gggtctggtg       120
     gggtacgtca acggcaccgg aaaggccacc ggcggatggg ccccggtgca ggtggttctg       180
     cagcagttcg cgcaaggcaa gttcctcggc ctgctcaccg tcatgttcgg catcgggctg       240
     gtcatccagc agcgttccgc cgagcggcgc ggtcagcggt ggcccggtgg atacccgtgg       300
     cgcgcagcgc tgctgatgct cgacggcgca ctgcacttcc tgctgttcac cgagttcgac       360
     gtcctgaccg ggtacgcgct caccggactg atcgtcgcct tcatcctgac cgcgggcatc       420
     cgcgcgcaac gaacgtggat cgtgtgcgcg gtggccgttc acgcggcgat gctcgccctc       480
     ctcgtcgccg ccctgtactc ggcgccggca cgggagccgc agccgctgtc gccgaatccc       540
     tatgcggacg gcagcttctg ggatctcatc gtcttccgcg ccgacaacgt gttgctgttc       600
     cggctcgagg tgctgttcat cctgccgctg tcgatcgcac tgttcctcgt cggcgcgcgc       660
     ctctacggtg cgcgcgtcct cgacccggac cgtggcgtcc tgcgtcgccg cctgatggtc       720
     gcgggcctgg cgatcgccct gccgctcgac ctcgcgctcg gactgttcgg tggagacgcg       780
     ggtctgatcc tcggcaggta cgggactgcg ccgatagtgg cgttggggct actcgcagcg       840
     atcgcgcacc gctacgccga cggccgcgca cccggcgcgc ccggccgggc actctcgggc       900
     gtcggccgcg ccgcgctcag ttgctatgtg ctgcagaata ttctgtgttc gatcgtctgc       960
     tacggctggg gattcggcct ggcggcccga ttggacggca ccaccgtggt tccggcgacg      1020
     atcgcgttgt tcggtgccgt ctccgcgacg ctgatcgtcg tgtcgcgcct gtggttgcgc      1080
     cgattcgatc gtgggccgct cgaatggctc acgcatcggg cctaccagcg tctcacccgg      1140
     gcggaccggg acggcgtcac cgcgccagca gcgtcgtcca ttccgtga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page