(data stored in ACNUC7421 zone)

EMBL: AP011115.PE286

AP011115.PE286       Location/Qualifiers
FT   CDS_pept        complement(304882..305535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48533"
FT                   /db_xref="GOA:C1AR56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR56"
FT                   /protein_id="BAH48533.1"
FT                   /translation="MPSETRHSEGRPYVVAHVAVALDGATTGFEPDVGRFYELAATWRE
FT                   DVTLVGADTIVAQEQALAAAPRPGPVGDGPLLAVVDSRGRVGDWVWDALRDAGHWSEVL
FT                   ALHAEATPPRGDGRSVHELVTGTERVDLAAALKILGRRAGVEVVRVDSGGALLGALLGA
FT                   GLLDEVSLLVHPCLPGVRNNRLWHGTAPAAIRFDLIASRAFDDGVVWLRYQPVR"
     atgccgtcag agacacgcca ttcggagggg cgtccctatg tcgtcgctca tgttgcggtc        60
     gccctggacg gggccacgac gggctttgag ccggatgtgg gccggttcta cgaactcgcc       120
     gcgacctgga gagaagacgt gaccctggtg ggggcggaca cgattgtggc gcaggagcag       180
     gccttggctg ccgctccccg ccccggcccg gtcggagacg ggccgctgct ggccgttgtc       240
     gacagccggg gacgcgtcgg agactgggtg tgggatgcgc tgcgggacgc cggacactgg       300
     tcggaggtgc tcgcattgca cgccgaggcc acaccgccgc gcggagatgg ccgatcggtg       360
     cacgagttgg tgacaggtac cgagcgtgtg gatctggctg ctgcgctgaa gattctcggc       420
     aggcgcgccg gtgtggaggt cgtgcgggtg gacagtgggg gtgcgctgct cggcgccctg       480
     ctcggcgcgg ggttgctgga tgaggtgagt ttgctcgtcc acccctgtct tcccggcgtg       540
     cggaacaatc gtctgtggca cggaactgca ccagcggcga tccggttcga cctcatcgcg       600
     agccgtgcct tcgacgacgg cgtcgtctgg ctccgctatc agcccgtgcg ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page