(data stored in ACNUC7421 zone)

EMBL: AP011115.PE29

AP011115.PE29        Location/Qualifiers
FT   CDS_pept        complement(24521..25015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00290"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48276"
FT                   /db_xref="GOA:C1AS27"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS27"
FT                   /protein_id="BAH48276.1"
FT                   /translation="MDGRRDPNPTLPVDPDTAPRTPGPLHVRPAAIAAVGAGGLIGAPL
FT                   RYQFGVWFPQAAGGWPVTTFAINIVGAFLLGLLLEALTRLGPDDRWRQRVRLGVGTGVL
FT                   GSFTTYSTLAVDTDLLLRSHQWWEAGSYAAGTVLVGLVATTAGIAVGAQLRSRRTEAER
FT                   W"
     gtggacggtc gccgcgaccc gaatcccacc ctgccggtcg atcccgacac cgcgcctcgc        60
     accccgggcc cgctgcacgt gcgcccggcc gcgatcgccg cggtcggtgc cggcgggctg       120
     atcggcgccc cgctgcgcta ccagttcggg gtgtggtttc cccaggccgc gggtggctgg       180
     ccggtgacca cgttcgcgat caacatagtc ggggcgttcc tgctcgggct tctgctcgag       240
     gcactgaccc gcctcggccc ggacgaccgg tggcgccaac gcgtgcgcct gggggtgggc       300
     accggggtcc tcggctcgtt caccacctac agcaccctcg ccgtcgacac cgatctgctg       360
     ttgcgtagcc accagtggtg ggaggccggc agctacgcgg ccggcaccgt gctggtgggt       420
     ttggtggcca ccaccgccgg gatcgcggtc ggtgcgcaac ttcggtcgcg gcgcacggag       480
     gccgagcgat ggtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page