(data stored in ACNUC7421 zone)

EMBL: AP011115.PE290

AP011115.PE290       Location/Qualifiers
FT   CDS_pept        complement(308247..308642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48537"
FT                   /db_xref="GOA:C1AR60"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR60"
FT                   /protein_id="BAH48537.1"
FT                   /translation="MGRVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDVADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDR"
     atgggccggg tgaccacaga attcgatcgg gtgtcgtccg cgaagtatgt cctgctcacc        60
     acgtttcgga aggacggcac cccggtggcg acgccgctgt gggccgccgc cgacggtgac       120
     cgtctgctga tgtggacggt caccgactcc tacaaggtca aacgcatccg ccgcaatccg       180
     gaggtgacgg tggcggcgtg cgatgcgcgc ggcaagccga aggggcccga agttcccgcc       240
     cgggccgtca tcctcgacgt cgcggacacc gatcacacgc gggacgtgat cgcccgcaag       300
     tacggcatcc tcggctggct cacgatgaaa ggcagcctcc tgcggcgcgg gaagaccggc       360
     accatcggtc tcgccgtcac ggccgacgat cggtag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page