(data stored in ACNUC7421 zone)

EMBL: AP011115.PE299

AP011115.PE299       Location/Qualifiers
FT   CDS_pept        complement(319529..319882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48546"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR69"
FT                   /protein_id="BAH48546.1"
FT                   /translation="MNAATDRQWAVRDAVLRWLLAKVTEGYRSPILDADAIGETVGWAP
FT                   SPLTRDEVADASNYLYREGHVTGVPVMGIGIPRPMLTVAGRRVAKAGRSLRPANCRHEV
FT                   DGGHSVLETGLLQ"
     gtgaatgcag ctaccgatcg tcaatgggcg gttcgtgacg ctgttctgcg ttggcttctc        60
     gcgaaggtca cggaaggata tcggagtccg attctggacg ccgacgccat cggtgagacc       120
     gtcggctggg cgccgtcgcc cttgacccgc gacgaagtgg ccgatgcgtc gaattacctc       180
     taccgagagg gacatgtgac aggcgtgccg gtgatgggca tcggaattcc gcgtccgatg       240
     ctgaccgtgg ccggacggcg cgtcgcgaag gcgggaaggt ctctgcgccc ggcgaattgc       300
     cgtcatgagg tcgacggggg ccattcggtc ctggaaaccg gcctccttca gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page