(data stored in ACNUC7421 zone)

EMBL: AP011115.PE3

AP011115.PE3         Location/Qualifiers
FT   CDS_pept        complement(1496..1861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48250"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS01"
FT                   /protein_id="BAH48250.1"
FT                   /translation="MADGSHYTYRVTWSEPDSEFVGIVAEFPSLSWLAETQNEALDGIV
FT                   AVVRDVLEDMASTGEQPPVPIADRSYSGIFTVRTSPRVHRTLAVEAEEQGVSLNLLVNQ
FT                   KLSAPVGGRTGAETKAG"
     atggctgacg gatcgcatta cacctatcgg gtgacctggt cggaaccgga cagcgagttc        60
     gtcggcatcg tcgccgaatt cccctcgctg tcctggctcg cggaaaccca gaatgaggcc       120
     ctcgacggca tcgtcgccgt cgtccgcgac gtcctcgagg acatggcgag taccggcgag       180
     cagccgcccg tgccgatcgc tgaccgctcc tacagcggca tctttaccgt gcggacctct       240
     ccgcgggtgc accgcacgct ggcggtcgag gccgaggagc agggtgtctc gctgaatctg       300
     ctggtcaacc agaaactctc cgctcccgtc ggcggccgca cgggagccga aacgaaggcg       360
     gggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page