(data stored in ACNUC7421 zone)

EMBL: AP011115.PE30

AP011115.PE30        Location/Qualifiers
FT   CDS_pept        complement(25363..26238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48277"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS28"
FT                   /protein_id="BAH48277.1"
FT                   /translation="MTLHRHIPRFLCTPKRVALAGDWHANTDYAVEAIAHARRRNADVV
FT                   IHLGDFGFNFKPDYLNALDRALAQHHLVLGFVDGNHENFDWLLAQPVAADGLRYLRQRI
FT                   VHLPRGLRWRWGNTRCLAVGGAHSIDTFLRTPQVTWWPQEEITAEQARSITDGGQGVDA
FT                   MFCHDCPAGIAVPGMERDRYGFPAEAVAASEHHRQVLRGIVDGVQPIRLWHGHFHHRYQ
FT                   AVLDGDGYRAVIDGLGRDKDPIDNNMVVVNLAALGNHQAASRDGQIRPEHAILYPEEEG
FT                   EPPTLSAVPG"
     atgaccctcc atcgacacat cccacgtttt ctatgcaccc cgaagcgggt ggcgctggcc        60
     ggggattggc acgccaacac cgactacgca gtggaagcca tcgcgcacgc ccgcaggcgc       120
     aacgccgatg tggtgattca tctcggtgac ttcgggttca acttcaagcc cgactatctg       180
     aacgcgctcg accgcgcgct cgcccagcat catctggtgc tcggattcgt cgacggcaac       240
     cacgagaact tcgactggct gctggcccag cccgtcgccg cggacgggtt gcggtacctg       300
     cggcagcgga tcgtgcacct gccgcggggc ctgaggtggc ggtgggggaa cacccggtgt       360
     ctggccgtcg gtggtgcgca ttcgatcgac actttcctgc ggacgccgca ggtgacgtgg       420
     tggccgcagg aggagatcac cgctgagcag gcccgcagca tcaccgacgg cggtcagggt       480
     gtggatgcga tgttctgcca cgactgcccg gcggggatcg cggttcccgg gatggagcgg       540
     gaccgatacg ggttccctgc cgaggcggtc gccgcctccg aacaccaccg tcaggtgttg       600
     cgcggaatcg tcgacggtgt gcagccgatc cggttgtggc acggtcattt ccaccaccgc       660
     tatcaggcgg tcctcgacgg cgacggatac cgggccgtga tcgacggact cggccgggac       720
     aaggacccga tcgacaacaa catggtcgtg gtgaacctgg ctgccctcgg caaccatcag       780
     gcggcctccc gcgacgggca gatccgaccc gaacacgcaa tcctgtaccc cgaggaggag       840
     ggcgagcccc cgaccctgtc cgccgtgccc ggatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page