(data stored in ACNUC7421 zone)

EMBL: AP011115.PE300

AP011115.PE300       Location/Qualifiers
FT   CDS_pept        complement(320326..320688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03000"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48547"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR70"
FT                   /protein_id="BAH48547.1"
FT                   /translation="MTGANTHDSTMLQPLVAAIPGVKSRRGPRRRKPRKLRADKGYDYD
FT                   IHRRWLRERGIVPRIARRGIERNDRLGRYRWKIERTIAWLTGYRRMTIRYERHGEHFAG
FT                   FLHLAAALTCFKKLPT"
     gtgaccgggg cgaacaccca tgacagcacg atgctgcaac cattggtggc agcgattccg        60
     ggcgtgaagt ctcggcgcgg accacgccga cgcaagccgc gaaagcttcg cgccgacaag       120
     ggctacgact acgacattca ccgacggtgg ctgcgcgaac gaggcatcgt cccgcggatc       180
     gcccgccgcg gcatcgagcg aaacgatcgc ctcggccggt accgatggaa gatcgaacgc       240
     accatcgcct ggctcaccgg ctaccggcgc atgaccatcc gctacgagcg ccacggcgaa       300
     cacttcgccg gcttccttca cctcgccgcc gcactcacct gcttcaagaa gctccccaca       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page