(data stored in ACNUC7421 zone)

EMBL: AP011115.PE301

AP011115.PE301       Location/Qualifiers
FT   CDS_pept        complement(320775..321134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03010"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48548"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR71"
FT                   /protein_id="BAH48548.1"
FT                   /translation="MVDELSLRLVPDALWEIVEPLIPPFVARPQGGGSAPADDRAVFTA
FT                   IVYVLTSGCAWRHLPPSFGVTVPTAHRRFSAWVRDGVFEKLHREVLDRLGSAGELDWTA
FT                   AILDAASVRAKRGAH"
     gtggtagatg agttgtcact gaggttggtt ccggatgcgt tgtgggagat agtcgaaccg        60
     ttgattcctc cttttgtcgc ccggccgcag ggaggtggca gtgcgccggc cgatgaccgg       120
     gcggtgttca ccgcgatcgt gtacgtgctc accagcggat gtgcgtggcg gcacctgccg       180
     ccctcgttcg gggtaaccgt gccgaccgcg catcgacggt tcagtgcctg ggtgcgggat       240
     ggggtgttcg agaaactcca tcgcgaggtg ctcgatcgac tcggtagcgc gggcgaactc       300
     gactggacgg cagcgatcct ggacgcggca agcgtgcggg cgaaaagggg ggctcactga       360
//

If you have problems or comments...

PBIL Back to PBIL home page