(data stored in ACNUC7421 zone)

EMBL: AP011115.PE302

AP011115.PE302       Location/Qualifiers
FT   CDS_pept        complement(321359..322498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03020"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48549"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR72"
FT                   /protein_id="BAH48549.1"
FT                   /translation="MAGKVVKRAFKYRFYPTEVRADQLARTFGCTRYVYNRALAERSRA
FT                   WSKEGRRVSYADNSTMLTRRKREAETAWLAEPSKGPLQESLRQLQGAFDKFWRIQARYP
FT                   QFKRKGRSKDSATYFSNCLTFRGGQIRLAKQSEPLDIRWSRPLPEGATPSQVTVSRNAR
FT                   GEYHISILVEDTIPELDRTDRVVGLDAGITSLYTLSTGEKIPNPRHERRDRERLAKAQR
FT                   VLARKQKGSRNRAKARLKVAKIHGRIADRRRDYLHTLSTRLVRENQVIAIEDLSVRNMV
FT                   KNRSLSRAISDAGWSEFRSMLEYKADWYGRVVAIDRFHPSSKTCSVCGEVVSAMPLKVR
FT                   EWTCRCGVVHDRDVNAARNILAVGLAVAACGDGVRPPRT"
     atggcgggga aggtggtgaa gcgggcgttc aagtaccgtt tctatccgac tgaggtgcgg        60
     gcggatcagc tagctcgaac tttcggctgc actcgatatg tctacaatcg ggcgttggcg       120
     gaacgctcgc gtgcctggtc gaaggaggga cggcgggtga gctacgcgga caactcgacg       180
     atgctcaccc gacggaagcg ggaggcggag accgcgtggt tggcggagcc gtcgaaggga       240
     ccgttgcagg agtcgctgcg acagttgcag ggcgcgttcg acaagttctg gcgcatacag       300
     gcccgctacc cgcaattcaa gaggaagggg cggtcgaagg attcggcgac ctacttctcg       360
     aactgcctca ccttccgcgg cgggcagatc cggttggcga agcagtccga accgctggac       420
     attcggtggt cgaggccgct gccggagggg gcgacaccgt cgcaggtgac ggtgtcccgt       480
     aacgctcgcg gcgagtatca catctcgatc ctcgtcgagg acacgattcc cgaactcgat       540
     cggactgatc gggtggtcgg gctcgacgcc gggatcacga gcctctacac cctgtcgacg       600
     ggggagaaga ttcccaaccc gcgtcacgag cgcagggacc gtgagcggtt ggcgaaggcg       660
     cagcgggtgc tcgccaggaa gcagaaggga tcccgtaacc gggccaaggc ccggctgaag       720
     gtcgcgaaga ttcatggtcg gatcgcggat cggcgccgcg attatctgca cacactttcc       780
     actcggctgg tgcgcgaaaa tcaagtgatc gccatcgagg atctgagtgt gcggaacatg       840
     gtgaagaatc ggtcgttgtc tcgggcgatc tcggatgcgg ggtggtccga gttccggtcg       900
     atgctcgagt acaaggccga ctggtacggg cgggtggtgg cgatcgaccg gtttcatccg       960
     tcgtcgaaga cctgctcggt gtgcggggag gtcgtctcgg cgatgccgct gaaggtgcgg      1020
     gagtggacgt gccggtgcgg cgtcgtccat gaccgcgatg tgaatgcggc gaggaatatt      1080
     ttggccgtcg gactggcggt ggcagcctgc ggagatggtg tgagaccgcc ccgcacctaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page