(data stored in ACNUC7421 zone)

EMBL: AP011115.PE304

AP011115.PE304       Location/Qualifiers
FT   CDS_pept        323261..325357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03040"
FT                   /product="putative drug resistance efflux protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48551"
FT                   /db_xref="GOA:C1AR74"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR74"
FT                   /protein_id="BAH48551.1"
FT                   /translation="MICAIGPSMEVLLVGRAVQGLGGGLLAGLNYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVAAAIAVIAPRALPRTGRVRG
FT                   GRTRPGHVTRSAHPGDDRDQCGGDPRQPHPHADPDRSGSRLRRSVPGLGAAITAPGAAA
FT                   VDVPPGVVPEVDLPHHRGPRVRNRVRGLHTAVRSTARRIGAVRRGVPRRHDVGRLVGDH
FT                   DLQFRHLPTAGKDGGHAHRTARPRRRLAPHGGALARRRRTRRGDSVGRRAGRRRCGHRT
FT                   RLPAPDGRRHAEHRRRAGGRQGGGRAQHGRVDRDGCRVRGRRCAGQSRRTLDPRLRETA
FT                   LPRSRRHRNGRRVHRVSRDPGARRSALGPRREVVRATENVVGTGELRRMPAVRDAATVR
FT                   PQSLDRRLGPGDVVRVGCQRGVDHGYLLVRQGQLPGHPHLAGKPSVVPHALGAVRQRRP
FT                   VDRGRDPGRPAGIDEPGPGVCQRHRGSSGAGVAAIVADPEREPRDGSGASDVVHGHDGL
FT                   GRFDESNHRDTWDVGGRVPHLLGRFGFREHQPAQPGQAADRVEVALPVRGGCVVDPHPA
FT                   RIPFEPPRGATATVVLRGERQAVLEVDDQRIGAGGRRRGENLVPDRGDQKPASRHRDDD
FT                   LAALRCHDAHAVLSSAIPRSLRVTAGRRTRRSGVRRTCPGTASSGAAPPRAVRLRSRSP
FT                   RRPG"
     atgatctgcg cgatcggccc gtcgatggag gtcctcctcg tcggacgtgc tgttcaggga        60
     ctcggcgggg gcctgctcgc cggcctgaat tacgccgtac tgcgtgaagc gctgccggaa       120
     cacctgtggg ctcgggcgac cgcattggtc tcggcgatgt ggggcgtggg aactctcgcc       180
     ggaccggcga tcggcggcct gttcgcccaa ctcggccagt ggcgactcgc gttcgtcgcg       240
     ctggcggtgg tcgccgccgc cattgcggtg atcgcgcccc gcgcgttgcc gcgcactggg       300
     cgtgtgcgcg gggggcgaac ccgtcccggc cacgtcactc gctctgctca ccctggcgac       360
     gatcgcgatc agtgtggcgg ggatcctcgg caaccgcacc cacatgctga tcctgatcgc       420
     agtgggagtc gtcttcgtcg ttctgttcct ggcctgggag cggcgatcac cgcgccgggt       480
     gctgccgcgg tcgacgtacc gccgggggtc gtccctgaag tggatctacc tcaccatcgc       540
     ggtcctcgcg tccggaaccg tgtccgaggc cttcacaccg ctgttcggtc aacggctcgc       600
     cggattggcg ccgttcgccg cggggttcct cggcgccatg atgtcggtcg gctggtcggt       660
     gaccatgatc ttcagttccg acatctcccg accgcgggca aagacggcgg ccatgctcac       720
     cggaccgctc gtcctcgccg ccggcttgct cctcacggcg gcgctctggc gcgacgacgc       780
     cggactcgcc gtggtgattc tgtgggccgg cgtgctggcc gccgcaggtg cgggcatcgg       840
     actcgccttc ccgcacctga tggtcgccgc catgcagagc accgacgacg cgcaggaggg       900
     cgccaaggcg gcggccgggc tcaacacggt cgagttgatc gcgatggctg tcgggtccgc       960
     ggtcgccggt gtgctggtca atctcggcgc accctcgacc ctcgcctccg cgagactgct      1020
     cttcctcggt ctcggcgtca tcgcaacggt cggcgtgttc accgcgtatc gcgcgacccg      1080
     ggagcccgcc ggtcggcgct aggcccgcga cgcgaagtgg tccgcgcgac ggagaatgtc      1140
     gtgggcacgg gcgagctgcg gcggatgccc gccgtgcgtg acgcggctac cgtccgaccc      1200
     cagtcgctcg atcgtcgact cggcccagga gatgtcgtcc gagtcgggtg ccaacgcggt      1260
     gttgatcacg ggtacctgct cgttcgccag ggtcagcttc ccggtcatcc ccatctcgcg      1320
     ggcaagccga gcgtcgtccc gcacgctctc ggcgccgtgc gccagcgtcg gcccgtcgat      1380
     cggggccgcg atccgggccg cccggctggc attgacgagc cgggaccggg cgtatgccaa      1440
     cgccatcggg gttcgtccgg cgccggtgtc gcggcaatag tcgccgatcc cgaacgcgag      1500
     cctcgcgacg ggagcggtgc gagcgatgtc gtccacggcc acgacggcct cggccgattc      1560
     gatgagagca accaccggga cacctgggat gtcggcggcc gagtcccgca cctgctcggg      1620
     cgcttcggtt ttcgagagca tcagcccgcg cagcccgggc aggccgcgga tcgcgtcgag      1680
     gtcgcgctgc cagtgcgggg tggttgcgtc gttgatccgc acccagcccg gattccgttc      1740
     gagccacccc gcggcgcaac cgcgaccgtc gtccttcgcg gcgaacggca ggccgtcctc      1800
     gaggtcgatg accagcgcat cggcgccgga ggccgccgcc gcggcgagaa cctcgttccc      1860
     gaccgcgggg accagaagcc agcttctcgc catcgcgacg acgatctcgc tgcgctgcgc      1920
     tgtcacgatg ctcatgctgt tctctcctcg gccataccga ggagtctgcg cgtcaccgcc      1980
     ggacggcgca ctcgccgaag cggagtgcgg cggacgtgtc cgggcaccgc ttcgtcaggt      2040
     gcggcgccgc cccgtgcggt ccgcctcaga agtcgaagcc ccaggaggcc gggttga         2097
//

If you have problems or comments...

PBIL Back to PBIL home page