(data stored in ACNUC7421 zone)

EMBL: AP011115.PE309

AP011115.PE309       Location/Qualifiers
FT   CDS_pept        326989..328005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03090"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48556"
FT                   /db_xref="GOA:C1AR79"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR79"
FT                   /protein_id="BAH48556.1"
FT                   /translation="MTPLSRLVSAAALGTVAVLALAACSEPAAADSEQAGAGTLTVYTS
FT                   EPQAKIDALVAAFTAETGIDVEVFRAGTGDLTARIEAERTTGTIGADVLLAADAPTFEG
FT                   YKTAGMLQQYTPADVNALNPDVVDPDGYYVGTRIIPTVIAYNTAAVDAPPTAWKDLADP
FT                   KYRGKITLPNPDVSGAAAFNTAVWLSTPELGEGWLEALAANDPVVAESNGPVGQAVAAG
FT                   TQPVGIVVDYLVRELAAKGSPIALTYPTDGIPYISQPAGIFTDSDDAEAARKFVDFLVS
FT                   KQGQELAVEQQYLPVRGDVGTPDGAPALSDLALLTPDLQEITKIQDDAVRKFNGLVG"
     gtgacgcccc tgtcccgcct cgtttcggcc gccgcgctcg gcacggtcgc cgtgctcgcc        60
     ctcgccgcgt gctccgagcc cgccgcagcc gattccgaac aggccggcgc cggaacgctg       120
     acggtgtaca cctccgaacc gcaggccaag atcgacgcgc tcgtcgccgc attcaccgca       180
     gagacgggta tcgacgtcga ggtgttccgc gccggcaccg gcgacttgac cgcccgcatc       240
     gaggccgaac gcaccaccgg cacgatcggc gccgacgtgc tgctcgcggc cgacgccccg       300
     accttcgagg gctacaagac cgcggggatg ctgcagcaat acacccccgc cgacgtgaac       360
     gcactgaacc cggacgtcgt cgatcccgac ggctactacg tcggcacccg catcatcccg       420
     accgtgatcg cctacaacac cgcggcagtc gacgcgcctc ccacggcgtg gaaggatctg       480
     gccgacccga agtaccgcgg caagatcacg ctgccgaatc cggacgtgtc cggtgccgcc       540
     gccttcaaca ccgcggtgtg gctcagcacg cccgaactcg gcgagggctg gctcgaggcc       600
     ctggccgcca acgatccggt ggtcgccgag agcaacggac cggtcgggca ggccgtcgcg       660
     gccggaacgc agccggtggg catcgtcgtc gactacctgg tgcgggaact ggcggcgaag       720
     ggatcgccga tcgcgctcac gtatcccacg gacggcattc cgtacatctc gcagccggcc       780
     ggcatcttca ccgattcgga cgatgccgag gctgcccgca agttcgtcga cttcctcgtg       840
     agcaagcagg ggcaggaact cgccgtcgag cagcagtacc tgccggtgcg cggcgacgtc       900
     ggtaccccgg acggggcacc ggcactgtcc gacctggcgt tgctcacccc ggatctgcag       960
     gagatcacga agatccagga cgacgcggtc cggaagttca atggtctcgt cggttag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page