(data stored in ACNUC7421 zone)

EMBL: AP011115.PE310

AP011115.PE310       Location/Qualifiers
FT   CDS_pept        327989..329656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03100"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48557"
FT                   /db_xref="GOA:C1AR80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR80"
FT                   /protein_id="BAH48557.1"
FT                   /translation="MVSSVRTVSSNAARALPGQRFDPVGAVRVALWLFAAAVIVAPLAT
FT                   VVSLGFGGNHIAQLIDGGIAGAATHSAVSAGLSAVFAVALATVMALLLDRTDLPGRGIL
FT                   RLILLSPLLIPPFVGAIAWTGLLGPSGLVNRFWAERFGGPLWNIYGGDGVVFLLTVHSY
FT                   PLAYLIIAAALRKVPGDLEQIARIGGASPWRAMRTVTLPLLRPALLAAFTLTAVSNLAD
FT                   FGIPALIGLPERYVTLSTMVYRYIQSGTVDRPLEVVSTIGVVLLLLAVLAVFVDRRLSR
FT                   RSRQLDGPVTAPQPLPLGGGRIPVGTLAWTVGLALTGLPIFALASQALLPAPGVPLAWD
FT                   NLTLESIAAAVTAPGTVVGVQNSLLLAVGAGIVCAVAGLVLGVLTTRTRSRDNASLDLL
FT                   AMLPQAVPGLVIAVGWLIVGRYTGLFDTRWVILCAYVTAFLAIVVQAVRAPLSTTPASL
FT                   EEAARASGASRLRTLRDVPVAMTVPAAATGGVLVALTAVRELTMSVLLVAPGTQTLGVS
FT                   IFNLQQAGDYNAASALSLLVTIVGIAGLGLFAGTRAGR"
     atggtctcgt cggttaggac cgtttcctcc aacgctgccc gggccctgcc cgggcagcgg        60
     ttcgatcccg tcggtgccgt gcgggtggcg ctgtggttgt tcgccgccgc ggtgatagtc       120
     gcgccgctcg ccaccgtcgt gtcactcggg ttcggcggca accacattgc gcaactgatc       180
     gacggcggca tcgcaggcgc cgcgacccac agcgcggtct cggccggcct gtcggcggtg       240
     ttcgcggtcg ccctcgctac cgtgatggcg ttactgctcg accgcacgga tctgcccggc       300
     cgcggcattc tgcgcctgat cctgttgtcg ccgttgctga tcccaccgtt cgtcggggct       360
     atcgcgtgga ccggacttct cggcccgagc ggcctcgtga accgattctg ggcggagcgg       420
     ttcggtggtc cgctgtggaa catctacggc ggtgacggcg tcgtcttcct gctcacggtg       480
     cattcgtacc cgctggcgta cctgatcatc gcggcggcgc tgcggaaggt gccgggtgac       540
     ctcgagcaga tcgctcggat cgggggcgcc tccccgtggc gcgcgatgcg caccgtgacg       600
     ctgccgctgt tgcgtcccgc actgctcgcc gcgttcaccc tcaccgcggt gtcgaatctg       660
     gccgacttcg ggattcccgc actgatcggc ctgccggagc gttacgtcac gttgtcgacg       720
     atggtgtacc gctacatcca gtccggcacg gtggaccggc cgctcgaagt ggtctccacc       780
     atcggggtcg tgctgctgtt gctcgccgtc ctcgcggtgt tcgtcgatcg gcgactgtcg       840
     cggcgcagca ggcaactcga cggtccggtc accgccccgc agccgttgcc gctcggcggt       900
     ggccgcatcc cggtcggcac gctcgcctgg accgtcggtc tcgcgctgac ggggcttccg       960
     atcttcgcgc tcgcctccca ggcgctgctg cccgccccgg gcgtcccgct ggcctgggac      1020
     aacctgacgc tcgaaagcat cgcggcagcc gtgaccgcac cgggcaccgt agtcggcgtg      1080
     cagaactcgc tcctgctcgc cgtcggcgcg ggaatcgtgt gcgctgtcgc gggcctcgtg      1140
     ctcggggtgc tcaccacccg cacccggtcg cgggacaacg cgagcctcga tctgctggcg      1200
     atgctgccgc aggccgtacc cgggctggtc atcgcggtgg gctggctgat cgtcggccgc      1260
     tatacgggtc tgttcgacac ccgttgggtg atcctgtgcg cctacgtcac cgcgttcctg      1320
     gcgatcgtcg tgcaggcggt gcgtgcgccg ttgtccacca cccccgcgtc gctggaggag      1380
     gcagcacgcg catccggcgc gtcgcgcctg cggacattgc gggacgtgcc ggtggcgatg      1440
     acggtgcccg ccgcggcgac cggcggtgtg ctggtggcgt tgaccgcggt acgcgagctg      1500
     accatgtcgg tgctgctcgt cgcacccgga acccagacgc tcggggtctc catcttcaac      1560
     ctgcagcagg ccggcgacta caacgccgca tccgccctgt ccctgctcgt cacgatcgtc      1620
     ggcatcgccg gtctcggcct gttcgccggc acccgcgccg ggcgctga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page