(data stored in ACNUC7421 zone)

EMBL: AP011115.PE316

AP011115.PE316       Location/Qualifiers
FT   CDS_pept        complement(334379..334873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48563"
FT                   /db_xref="GOA:C1AR86"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR86"
FT                   /protein_id="BAH48563.1"
FT                   /translation="MTNKRISRLRGASVDYAIAAFRVVIGFLFFCHGTSTLFAWPTAPH
FT                   SGHTAAVGAWPSWWGAVIQLVCGAALFLGLGTRIAAFLASGSMAYAYFWSHQPDGALPI
FT                   QNNGELSAIFCWALFLMIFLGGGALSLDRLIAHGVRTARVDDEAAAGEPGSTDELREVN
FT                   A"
     gtgacaaaca agaggatctc acgccttcgc ggcgccagtg tcgactatgc catcgcggcg        60
     tttcgcgtgg ttatcggctt cctattcttc tgccatggaa cttcgacgtt gttcgcgtgg       120
     ccgaccgcgc ctcacagcgg gcacaccgca gcggtaggtg cctggccgag ctggtggggt       180
     gccgtgatcc aactcgtctg cggcgccgcg ctgttcctcg gtctcgggac gcgaatcgcg       240
     gcgttcctcg cctcgggttc gatggcgtac gcctacttct ggagccatca gccggacggt       300
     gctctcccca tccagaacaa cggtgaactc tctgccatct tctgctgggc cctgttcctg       360
     atgatcttcc tcggcggcgg tgcactctcg ctcgatcgcc tcattgctca tggcgtgcgc       420
     accgcacggg tcgacgacga agctgccgcc ggcgagcccg gatccacgga cgagttgcgg       480
     gaagtgaacg cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page