(data stored in ACNUC7421 zone)

EMBL: AP011115.PE317

AP011115.PE317       Location/Qualifiers
FT   CDS_pept        335041..335976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48564"
FT                   /db_xref="GOA:C1AR87"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR87"
FT                   /protein_id="BAH48564.1"
FT                   /translation="MLSMRDFRFSFNIFGFDSRDALLDRCRLGESAGYDTVFAADHLGA
FT                   PAPFPLLVAVAGATGLRVGTLVLNAPFWNAALLAREIATTDVLTDGRLEVGLGAGHMKW
FT                   EFDAAGVEWKAFGGRVEQLSELVDGLRTCFTTDFAELPEDRTVPRPLQRRGFGGSGPPL
FT                   IIGGTGDRVLRIAAAHADIVGVAGTFQIPGRPPGTFRLATADEAAERIRFVRTHAGARA
FT                   ERIEWHLLVQLVVETDDRRAAANEIAERLGGTMSVDDVLGTPYVLVGTVEEMAGQLRSH
FT                   RERYGFSYITVHEPYLEVFAPVIRRLREQN"
     gtgttgtcca tgcgcgattt ccgattctcg ttcaacatct tcggcttcga ctcccgcgat        60
     gcccttctcg atcgatgccg gctcggtgag agcgccggct acgacaccgt gttcgccgcc       120
     gaccatctcg gcgccccggc tccgttcccc ctgttggtgg cggtcgccgg cgccaccgga       180
     ctgcgggtcg gaactctggt gctcaacgca ccgttctgga acgccgccct gctcgctcgc       240
     gagatcgcga cgacggacgt cctcaccgac ggaagactcg aggtcggtct cggtgcgggg       300
     cacatgaagt gggagttcga cgccgccggt gtcgaatgga aggctttcgg cggccgggtc       360
     gagcagttgt cggagttggt cgacgggctg cgcacgtgct tcacgacgga cttcgccgag       420
     ctaccggagg accgcaccgt gccacgaccg ttgcagcgtc gaggattcgg cggctcgggt       480
     ccacccctga tcatcggcgg taccggcgac agggtgctgc ggatcgcggc cgcccacgcc       540
     gacatcgtcg gtgtcgcggg gacgtttcag attccgggcc ggcccccggg cacattccgt       600
     ctcgccaccg cggacgaggc cgccgagcga attcggttcg tacggacaca cgccggtgcg       660
     agagccgaga ggatcgaatg gcatctactg gtccagttgg tcgtcgagac ggacgaccgc       720
     cgggccgcgg cgaacgagat cgccgagcgg ctcggcggca ccatgtcggt ggacgacgtc       780
     ctcggcaccc cgtacgtcct cgtgggaacc gtggaggaga tggccgggca actccggagc       840
     catcgggagc gttacggttt ctcgtacatc accgtccacg agccgtatct ggaggtgttc       900
     gcccccgtga tccgccgact ccgcgaacaa aattga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page