(data stored in ACNUC7421 zone)

EMBL: AP011115.PE318

AP011115.PE318       Location/Qualifiers
FT   CDS_pept        complement(335988..336374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48565"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR88"
FT                   /protein_id="BAH48565.1"
FT                   /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNPGMPALAIPGRHE
FT                   VDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCVSMFPGSLAGCIIGTPIGAIT
FT                   GAIVGMGQGNPRAAQAIQEYINTP"
     atgaacttga tcaagaaatc ggcagcatcg gtcctcgtcg cagcgacggt gacactcgga        60
     gcgggtacgg cgcacgccga ccccgtcgta ccgaacccgg gaatgccggc actggcgatc       120
     cccggccggc acgaggtcga caagcagaag gccctcgaga acatgctcaa cgaactcggc       180
     gtcggctggg ccaacggggg agcggccggc acggcgatag gcgcgctcat gggtctcggc       240
     gtcggatgtg tctcgatgtt ccccggcagt ctcgccggct gcatcatcgg cacgccgatc       300
     ggtgcgatca ccggtgcgat cgtcggtatg ggacagggca atcccagggc ggcgcaggcc       360
     atccaggagt acatcaacac gccgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page