(data stored in ACNUC7421 zone)

EMBL: AP011115.PE319

AP011115.PE319       Location/Qualifiers
FT   CDS_pept        complement(336502..337290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03190"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48566"
FT                   /db_xref="GOA:C1AR89"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR89"
FT                   /protein_id="BAH48566.1"
FT                   /translation="MTTMGYALSDSATMLRRNLRHMIRYPSVTVLLVGMPIVLLLLFVY
FT                   VFGGTLGAGLGDPAGGRGAYIDYVAPGILLMTVASAAQGTAISVATDMTEGIIARFRTM
FT                   AIARVSVLTGHVIGSMIQTLISLVLVVGVAVLIGFRPTAGIGEWVAATAVLAMFAFALT
FT                   WLSVAFGLVSKSVETASNLPMVLILLPFLGSGFVPTDSMPAGLRWFAEYQPFSPVIETV
FT                   RALLLGGPVGSSAVLAVGWSAGIALFGYLWAKRLFNRRVN"
     atgacgacca tgggttacgc gctgagcgac tcggcgacga tgctgcgacg caacctccgg        60
     cacatgattc ggtacccgtc ggtgacggtg ctcctcgtcg ggatgccgat agttctcctc       120
     ctgctcttcg tgtacgtctt cggtggcacg ctgggcgcgg gtctcggtga tcccgccggc       180
     ggccgcggcg cctatatcga ctacgtggca cccggaattc tgttgatgac cgtggccagt       240
     gcggcccagg gaaccgcgat ttcggtcgcc accgacatga ccgagggcat catcgcccgg       300
     ttccggacga tggcgatcgc acgggtgtcc gtgctgaccg ggcacgtcat cggcagcatg       360
     atccagacac tgatcagcct cgtgctggtc gtcggtgtcg ccgtgctcat cgggttccgg       420
     cccaccgccg ggatcgggga gtgggtggcg gcgacggcgg tgctcgcgat gttcgcgttc       480
     gcactcacct ggctgtccgt cgcgttcggg ctggtgtcca agagcgtcga gacggcgagc       540
     aacctcccga tggtgttgat actgctgccg ttcctcggca gcggattcgt tcccaccgac       600
     tcgatgccgg ccggtctccg gtggttcgcc gagtaccagc cgttcagccc tgtcatcgag       660
     accgtccgcg cactgctgct gggcggtccc gtcggcagta gcgcagtact cgcggtcggg       720
     tggagcgccg gcatcgcgct gttcggttac ctctgggcga aaagactgtt caaccggcgc       780
     gtgaattga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page