(data stored in ACNUC7421 zone)

EMBL: AP011115.PE321

AP011115.PE321       Location/Qualifiers
FT   CDS_pept        complement(338249..339127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48568"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR91"
FT                   /protein_id="BAH48568.1"
FT                   /translation="MPTFSTPAPISATVELVVGDARITATDRDDTVVDVHPSDGSRESD
FT                   VRAAEQTRVEYSAGRLLVKAPKQRGLGLFGKAGSVDVTIALPTGSEFEGEASVATFHGA
FT                   GRLGACRVKTSAGDVHLGDTGPLDVHTGAGAVTVDHVAGDADLSTGSGKLRAGAIDGSA
FT                   VIKNSNGDNWIGTIAGGLRVKTANGDISVDDARADLAAATANGDIRIGQVTRGAASVET
FT                   GHGRIEIGIRSGTAARLDAHTSFGKVHNHMDSVDRPESTDDKVDVRARTGFGDIVIRRV
FT                   DTQESTSRKAQ"
     atgcccacat tcagcacccc ggcgccgatc tcggccacgg tcgaactcgt cgtcggcgac        60
     gcgcggatca cggcgaccga ccgcgacgac acagtcgtgg acgtgcaccc cagcgacggc       120
     tcgcgggaat cggacgttcg cgccgccgag cagacccgcg tcgagtattc cgcgggaaga       180
     ctgctggtca aagcgccgaa gcagcgcggt ctcggcctgt tcggcaaggc cggctccgtc       240
     gacgtcacca tcgcgctgcc gaccggctcc gagttcgagg gcgaggcgtc ggtggcgaca       300
     ttccacggtg ccggacggct cggtgcatgc cgggtcaaga cgtcggcggg cgacgtccac       360
     ctcggcgaca cgggcccgct cgacgtgcac accggtgccg gcgccgtcac cgtggaccac       420
     gtcgcgggag atgcggacct gagcacgggg tcgggaaaac tccgcgccgg tgcgatcgac       480
     ggcagcgccg tgatcaagaa ttccaacggc gacaactgga tcggcacgat cgccggcggt       540
     ctgcgggtga agacggcgaa cggggacatc tccgtcgacg acgcccgcgc cgacctcgcc       600
     gccgcaacag cgaacggcga catccgaatc ggtcaggtga cgcggggcgc ggcgtcggtc       660
     gagaccggcc acggccgaat cgagatcggc atccgctccg gtaccgccgc acgtctcgac       720
     gcgcacacgt ccttcgggaa ggtgcacaac cacatggact ccgtcgaccg gcccgaatcg       780
     acggacgaca aggtcgacgt gcgcgcccgt accggcttcg gcgacatcgt gattcgccgc       840
     gttgataccc aggaatcgac cagtcgaaag gcacagtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page