(data stored in ACNUC7421 zone)

EMBL: AP011115.PE327

AP011115.PE327       Location/Qualifiers
FT   CDS_pept        343947..344276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48574"
FT                   /db_xref="GOA:C1AR97"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR97"
FT                   /protein_id="BAH48574.1"
FT                   /translation="MDALRDRGEMEAQNLRQKFKEWLAALVHEVVHSNAGVGAGLEGIR
FT                   AALTGKNPVWAAIKALVSGLSGKAKFGLILLLVVALLLGPVLLVILLLVLLVAVIVAAV
FT                   RAATQ"
     gtggacgcac tgcgggaccg cggcgagatg gaggcgcaga atcttcggca gaaattcaag        60
     gaatggttgg ctgccctcgt ccacgaggtg gtacacagca acgccggggt cggagccgga       120
     ctcgaaggca ttcgcgccgc cctgacgggc aagaatccgg tgtgggccgc gatcaaggcg       180
     ctggtctccg gtttgagcgg caaagccaag ttcggcctca tcctgcttct cgtcgtcgcg       240
     ctcctgctcg ggcccgtatt actcgtaatt cttctgctgg ttcttcttgt cgcagtgatc       300
     gtcgcagcgg tgcgagccgc cacccagtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page