(data stored in ACNUC7421 zone)

EMBL: AP011115.PE328

AP011115.PE328       Location/Qualifiers
FT   CDS_pept        344567..345274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48575"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR98"
FT                   /protein_id="BAH48575.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKVLANSPEFAKISDSVREELVSAAKAAAVTAASQRINKLNNRLLSGGGEAVSDV
FT                   GDTVDDTVGGVGNSVGKLSSLGKLGRKRRGRSKDEEYDESEVDEEPDEQYAEEDEDYEE
FT                   PEEEEPSDDEDEPPRRKRPAARRRASSNGSSRPTSRSRSAKSDEDDEEAPARGRRTRAK
FT                   ATTDSAPVRRGGR"
     atgaaaacca aaggtcaggt ggcattggcc gtcggcgcgg ggtacatgct gggccgtaca        60
     cacaggatga aaatggcact gatgctcgcg gctgcgggtg cgaccggacg cttccccggc       120
     gggccacgcg atttactgga acgcggcacg aaggtgctcg cgaattctcc cgagttcgcc       180
     aagatcagcg actcggttcg ggaagagctg gtcagcgcgg cgaaggccgc agcggtcacc       240
     gccgcaagcc aacgcatcaa caagctgaac aaccggcttc tgtccggcgg aggcgaagcc       300
     gtcagcgacg tcggcgacac cgtcgacgac actgtgggcg gtgtcggaaa ctcggtaggc       360
     aaactcagca gtctcgggaa actcggtcgc aagcgacgtg gtcggtccaa ggacgaggag       420
     tacgacgaat ccgaagtcga cgaagagccg gacgaacagt acgccgaaga agacgaggac       480
     tacgaggagc cggaagagga agaaccctcc gacgacgagg acgaaccccc tcggcgcaaa       540
     cgaccggcag cgcgtcggcg cgcgtccagc aacggcagct cccggccgac gagcaggtcg       600
     cgcagcgcga aatccgacga ggacgacgag gaagccccgg cccgcggccg tcggacacgc       660
     gccaaagcca cgactgattc cgcgcccgtc cggcgcggcg gacggtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page