(data stored in ACNUC7421 zone)

EMBL: AP011115.PE329

AP011115.PE329       Location/Qualifiers
FT   CDS_pept        345271..346437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48576"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR99"
FT                   /protein_id="BAH48576.1"
FT                   /translation="MSTMTNAAKKLREAAPGDGNGSSGVLQDALQKLVGTVTEKALSSV
FT                   TDKVQNASGRLTDYAEGGGGGLLAAVTGSEKLAEGESPIKSAVSGGWESAKQMAKDTAS
FT                   DVKEAVTGGGGSKGKKLKLTNIVETLDVGVPVQLAYNQWTQFADFPSFMKKVERVEQES
FT                   DEKLEWKAQVFLSHRTWEASIIEQVPDERIVWHSKGAKGYVDGAVTFHEVTPDLTRIVL
FT                   ILEYHPKGLFEKTGNIWRAPGRRARLELKHFGRHVMTQSVLHPDEVVGWRGEIRDGEVV
FT                   EPDEDETQQDEDETQPDESGELEETDDNEDEESEEEEEEPEQEESEETDEDESEDTDED
FT                   EETPPPARRGRPRKTAASSEERAAPKRRGRPRKTAAKKAAGSRQGARQ"
     gtgagcacga tgacgaacgc cgcgaagaaa ctgcgagaag ccgcaccggg agacggcaac        60
     ggatcgtcgg gcgtgctgca ggatgcactg cagaagctgg tcggcacggt gacggagaaa       120
     gcgctctcgt cggtcaccga caaggtgcag aacgcatccg gcaggctcac cgactacgcc       180
     gagggcggcg gcggaggact gctcgccgct gtgaccggtt ccgagaagct cgccgagggt       240
     gaatcaccga tcaaatccgc ggtgagcggt ggctgggaga gcgccaagca gatggccaag       300
     gacaccgcct ccgacgtcaa ggaggccgtc acgggtggtg gtggcagcaa aggcaagaag       360
     ctcaagttga ccaacatcgt cgagacgctc gatgtcggag tcccggtcca gctcgcctac       420
     aaccagtgga cccagttcgc cgacttcccc tccttcatga agaaggtcga gcgggtagag       480
     caggaatcgg acgagaagct cgagtggaag gcacaggtgt tcttgtccca ccgaacctgg       540
     gaagcgtcga tcatcgagca ggtgcccgat gagcggatcg tgtggcactc gaagggtgcc       600
     aagggttatg tcgacggcgc cgtgacgttc cacgaggtaa cccccgatct cacccgcatc       660
     gtactcatcc tcgagtatca cccgaagggt ctgttcgaga agacgggcaa catatggcgg       720
     gcgccgggac gacgagcgcg gctcgagttg aagcacttcg ggcgccacgt catgacgcag       780
     tcggttctcc atcccgacga ggtggtcggc tggcgcgggg agatccgtga cggcgaggtt       840
     gtcgagcccg acgaggacga gacacagcag gacgaggacg agacgcagcc ggacgagtcc       900
     ggggaactcg aagaaaccga cgacaacgaa gacgaggaga gcgaggaaga ggaagaggaa       960
     cccgagcagg aggaatccga ggagaccgac gaagacgagt ccgaggacac cgacgaggac      1020
     gaggaaacgc ccccgccggc gcgccgaggt cgcccacgca agaccgcggc aagttccgag      1080
     gagagagcag ccccgaagcg gcggggtcgc ccgcgcaaga ccgcggccaa gaaagccgcc      1140
     ggctcgcggc aaggagcccg gcaatga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page