(data stored in ACNUC7421 zone)

EMBL: AP011115.PE33

AP011115.PE33        Location/Qualifiers
FT   CDS_pept        complement(27845..28666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48280"
FT                   /db_xref="GOA:C1AS31"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS31"
FT                   /protein_id="BAH48280.1"
FT                   /translation="MISAHDAHTTGTLGSGTVVALLLIAAVAAGYLVLAVRRRREARGW
FT                   SIWRSASFLTGIALLALAVTPTLSPYPVGDFRGHMHQHLLLGMYAPLGLVLGAPITLLL
FT                   RSIPPRHGRPIGRVLRSRPAHLLAHPVVALTLSVGGLAALYFTPLYTATTTDEALHLLV
FT                   HTHFLLAGYLFAWVIAGPDPAPHRPSVPVRLVVLGVAIAGHAVISQLMYAGLFVQIPVP
FT                   PDQRQGAGELMYYGGDVAELLLAVALLLTWRPDRHRPARPTDQISAPTAAT"
     atgatctccg cacacgacgc gcacaccacc ggcaccctcg ggtcgggcac cgtcgtggcc        60
     ctgctcctga tcgccgccgt ggccgccggc tatctcgtcc tcgctgtgcg gcggcgccgc       120
     gaggcccgcg gctggagcat ctggcggagc gccagctttc tcaccggcat cgccctgctc       180
     gcgctggccg tcaccccaac cctgtccccg tacccggtcg gcgacttccg cggccacatg       240
     caccaacacc tgctgctggg aatgtacgca ccactcgggt tggtcctcgg cgcaccgatc       300
     accctgctgc tgcgttcgat tccaccgaga cacggccgcc cgatcggccg ggtgctgcgg       360
     tcacgcccgg cacatttgct cgcccacccc gtcgtggccc tgaccctctc cgtcggcgga       420
     ctcgccgccc tgtacttcac cccgctctac accgcgacca ccaccgacga ggccttgcac       480
     ctgctcgtgc acacccattt cctgctggcc ggctacctgt tcgcctgggt catcgccggc       540
     ccggaccccg ccccccaccg cccgtcggtc ccggtccggc tggtggtgct cggtgtcgcg       600
     atcgccggac atgccgtgat ctcccaactg atgtacgccg ggctcttcgt ccagatcccc       660
     gtcccacccg accagcgtca gggagccggg gagctgatgt actacggagg cgacgtcgcc       720
     gaactactcc tcgccgtcgc gctgctgctc acctggcggc ccgaccgtca tcgcccagcg       780
     cgcccgacag accagatctc cgcgcctacc gcagcgacat ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page