(data stored in ACNUC7421 zone)

EMBL: AP011115.PE332

AP011115.PE332       Location/Qualifiers
FT   CDS_pept        347636..347887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48579"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA2"
FT                   /protein_id="BAH48579.1"
FT                   /translation="MGLMSFIVTLPLAPVRGVISLAELIQRQVEEELHNPASARRALEE
FT                   LEDARASGEISAEEEEQAQQAILDRMTGTARPNSPEKE"
     atgggcctga tgtcgttcat cgtcacgctg ccgctcgccc ccgtgcgtgg ggtgatctcg        60
     ttggccgagt tgatccagcg gcaggtcgag gaggaactcc ataatcctgc aagcgcgcgt       120
     cgcgctctcg aggagttgga ggacgctcgc gcgtcgggtg agatctccgc cgaggaggag       180
     gaacaggcac agcaggccat cctcgaccgc atgaccggaa cggcacggcc caacagtccg       240
     gagaaggagt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page