(data stored in ACNUC7421 zone)

EMBL: AP011115.PE34

AP011115.PE34        Location/Qualifiers
FT   CDS_pept        complement(28663..29208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48281"
FT                   /db_xref="GOA:C1AS32"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS32"
FT                   /protein_id="BAH48281.1"
FT                   /translation="MVAPQRETTAIPARGIGLPGIILGIGLGGFVDGILLHQLLQWHHM
FT                   LTSTDTDNVGIDTYPADTVHGLEINTVWDGLFHTFTWLAVLIGLGLLYSRVTHSHGRIW
FT                   ASRVLWGWVLVGWGLFNLVEGVIDHHLLGIHHVRGGDHQLWWDLGFLALGAVLVAGGWL
FT                   LQHSAAPAQPSADTTAPR"
     atggtcgcac cccaacgtga gacgaccgcc atccccgccc ggggaatcgg gttgcccggc        60
     atcatcctcg gcatcggact cggcggcttc gtcgacggga tcctgctgca ccaactgctg       120
     caatggcacc acatgctcac cagcaccgac accgacaacg tcggaatcga cacctacccg       180
     gccgacaccg tgcacggact cgagatcaac accgtctggg acgggctgtt ccacaccttc       240
     acctggctgg cggtcctcat cggcctcggg ctgctgtact cccgcgtcac gcactcgcac       300
     ggccggatct gggcgtcgcg ggtcctctgg ggatgggtgc tggtcggctg gggcctgttc       360
     aacctcgtcg aaggcgtgat cgaccatcac ctcctcggca tccaccacgt ccgcggcggc       420
     gaccaccaac tctggtggga cctcggcttc ctcgccctcg gggccgtcct cgtcgccggc       480
     ggatggctgc tgcaacacag cgccgcaccg gcgcaaccga gtgcggacac caccgccccg       540
     cgatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page