(data stored in ACNUC7421 zone)

EMBL: AP011115.PE341

AP011115.PE341       Location/Qualifiers
FT   CDS_pept        352224..352529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48588"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB1"
FT                   /protein_id="BAH48588.1"
FT                   /translation="MRSAIAAAAALAAFSAPGIAAAAPNLHGDPNTPGTQVQVESEPGD
FT                   SNSYTCGAVGVAGAGVGSNSSGGAGSVNGAYFGPGPVQGGCVGSDGSVYFPTGNAE"
     gtgcgctcgg cgatcgcagc agccgctgcc ctcgccgcct tttccgcacc cggtatcgcg        60
     gccgccgcac cgaacctgca cggggatccg aacacccccg gcacccaggt tcaggtggag       120
     agcgagccgg gcgactcgaa cagctacacc tgcggggcgg tcggcgtcgc gggcgccgga       180
     gtcggatcga attcctccgg tggcgccggt tcggtcaacg gcgcgtattt cggacccggt       240
     ccggtccagg gcggctgcgt gggtagtgac gggtcggtat acttcccgac cggcaacgcc       300
     gagtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page