(data stored in ACNUC7421 zone)

EMBL: AP011115.PE342

AP011115.PE342       Location/Qualifiers
FT   CDS_pept        complement(352820..353278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48589"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB2"
FT                   /protein_id="BAH48589.1"
FT                   /translation="MTTSDRQPEGTSPAGNVETPAEAPASAVEGTESPAGTTESAPGAA
FT                   TPPAAEAPPSAQDADTSVGQTLFAEDELSVLRLRWDEVQSGFVDDPRECVQKADGLVSD
FT                   VVDRITTGFSEARSRLEEQWARGEEGSTEDLRLALKRYREFFQRLLEL"
     atgacaacct cagaccggca acccgagggc accagcccgg ccgggaacgt cgaaacgccc        60
     gccgaggccc ccgcctcggc ggtcgaggga accgaatcac ccgccggaac aaccgaatct       120
     gcccccgggg ctgccacccc accggccgcg gaagcgccac cgtccgccca ggacgccgac       180
     acgtcggtcg ggcagacgct gttcgccgag gacgaactgt cggtactccg cctgcgctgg       240
     gacgaggtcc agtcgggctt cgtcgacgat ccccgagaat gcgtgcagaa ggcggacggc       300
     ctcgtgtccg acgtcgtcga ccggatcacg acggggttct cggaggcgcg ttcgcggttg       360
     gaggagcaat gggcccgagg agaagagggc tcgacggagg accttcgact cgctctgaag       420
     cgctatcgcg agttcttcca gcgactgctc gaactctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page