(data stored in ACNUC7421 zone)

EMBL: AP011115.PE343

AP011115.PE343       Location/Qualifiers
FT   CDS_pept        complement(353275..353862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48590"
FT                   /db_xref="GOA:C1ARB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB3"
FT                   /protein_id="BAH48590.1"
FT                   /translation="MPVWGWILIAVLVVIAVLAIIASRSISSRKRTERLKGRFGPEYER
FT                   TVGEVGDQGAAEKELAARERKREKLDIVPLPPEARAKYADSWRTVQIEFVDNPSSAVAA
FT                   ADRLVIHVMRERGYPIDDFDQRAADISVDHPKVVENYRTAHGIYLAQEQGDIGTEDQRE
FT                   AFVHYRELFEKLLETDENNDEPNKDEPKETRA"
     atgcctgttt ggggatggat cttgatcgcg gtgctcgtcg tgatcgcggt gctggcgatc        60
     atcgcttccc gctcgatcag tagtcgcaag aggacggaac gactgaaagg acggttcggc       120
     cccgaatacg agcggacggt aggtgaggta ggcgaccagg gcgcagccga gaaggagctc       180
     gcggcccgcg agcgaaagcg ggagaagctc gacatcgtcc cgttgccacc cgaggcgcga       240
     gcgaaatacg ccgattcctg gcggacggtg cagatcgagt tcgtcgacaa cccgtcgagc       300
     gcggtagccg ctgcggaccg gctcgtgatc cacgtcatgc gcgaacgtgg ttacccgatc       360
     gacgacttcg atcagcgcgc ggccgacatt tcggtggacc acccgaaggt cgtcgagaac       420
     taccgcacgg cgcacggcat ctatctcgca caggaacagg gcgacatcgg tacggaggac       480
     cagcgcgaag cgttcgtgca ctaccgcgaa ctcttcgaga agttgctcga gacggatgag       540
     aacaacgacg agccgaacaa ggacgagccg aaggagacac gcgcatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page