(data stored in ACNUC7421 zone)

EMBL: AP011115.PE348

AP011115.PE348       Location/Qualifiers
FT   CDS_pept        complement(357651..358133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48595"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB8"
FT                   /protein_id="BAH48595.1"
FT                   /translation="MTIDDIIDFVEGLDDVLTLRPVPGDGSPEISWGDTFFYYSPDGVV
FT                   PTTTQPFATIVTKNYPGDEDSRLDRAGAFRVNIHAGKEAFLATLGRAPREPGPAHTDAG
FT                   ASDTVIAHPVYGSAAWLAIVNPGPRTGRLTRELLCTAHALARSRYERRADAVRRQN"
     atgacgatag acgacatcat cgacttcgtg gaaggtctcg acgacgtcct caccctcagg        60
     ccggtcccgg gtgacggctc gccggagatc agctggggcg acaccttctt ctactactcg       120
     ccggatgggg tcgttccgac gacgacccag ccgttcgcca cgatcgtcac gaagaactat       180
     ccgggcgacg aagattcgcg gctcgaccgt gcgggtgcct tccgagtgaa tatccacgcc       240
     gggaaggagg cgttcctcgc gacgctcggc cgcgcaccgc gagagcccgg accagcccac       300
     accgacgccg gcgcatccga cacggtcatc gctcaccccg tgtatggctc cgcggcgtgg       360
     ctggcaatcg tgaatcccgg cccacgcacc ggtcgactca cccgcgagtt actgtgcacg       420
     gcacacgccc tggcccgatc gaggtacgag cgaagagcag atgccgtgcg tcgtcagaac       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page