(data stored in ACNUC7421 zone)

EMBL: AP011115.PE35

AP011115.PE35        Location/Qualifiers
FT   CDS_pept        complement(29291..30643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48282"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS33"
FT                   /protein_id="BAH48282.1"
FT                   /translation="MDVSIIETSSLGDRSYLISDGAVGVVVDPQRDIDRVLALARDRGV
FT                   RITHVLETHIHNDYVTGGLELSRTTGAEYVVPTGDDVGYQRRAVSDGDLIDAGPILLQV
FT                   LHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGKEHTEELTHAQYHSVR
FT                   RLADELPPDTEVYPTHGFGSFCAATPATGDSSTVGEQSKTNPALTRDEQSYVDELLAGL
FT                   ADYPAYYAHMGVLNTEGPPPVDLSLPKPVDPDELRRRIEDGEWVVDLRERTAFAAGHLG
FT                   GTLGFELSDSFVTYLGWLYTWGAPLTLIGDNEDQVADARRELVRIGIDDLDGAAVGEIH
FT                   TLVAGTALRSYRVADFAALSEALREKDITVLDVRQRNEYDDSHIDGAINIPLHELADRQ
FT                   STLPNREIWVHCASGYRASVAASMIDRPDRTTVLINDEFDNANDTDLTSTT"
     atggacgtgt cgatcatcga gacctcgagc ctgggcgatc gcagctacct gatcagcgac        60
     ggcgccgtcg gcgtcgtcgt cgacccgcaa cgcgacatcg accgggtact ggccctggcc       120
     cgcgaccgcg gcgtgcggat cacccacgtc ctcgaaaccc acatccacaa cgactacgtc       180
     accggcggcc tcgaactctc ccgcaccacc ggcgccgagt acgtcgtccc caccggtgac       240
     gacgtcggct atcagcggcg agccgtgtcc gacggtgacc tcatcgacgc cggcccgatc       300
     ctcctgcagg tcctgcacac ccccggccac acccaccacc acgtcagcta cgtgctgcgg       360
     gagaccaccg gcggcatccg cggcgtcttc accggcggat cgatgctctt cggcaccacc       420
     ggccgcaccg acctcctcgg caaggagcac accgaggaac tgacccacgc ccagtaccac       480
     tcggtgcgcc gcctcgccga cgagctgccc ccggacaccg aggtgtaccc cacccacggg       540
     ttcggcagct tctgcgccgc cacccccgcc accggggact cctccaccgt cggcgaacag       600
     agcaagacca acccggcgct gacccgggac gagcagagct acgtcgacga actcctcgcc       660
     ggcctcgccg actaccccgc ctactacgcc cacatgggcg tgctcaacac cgaagggccg       720
     cccccggtcg atttgtcact gcccaaaccc gtcgacccgg acgagctgcg ccgccgcatc       780
     gaggacggcg aatgggtggt ggacctgcgc gagcgcaccg ccttcgccgc cggccacctc       840
     ggcgggaccc tcggcttcga actgtcggac tcgttcgtca cctacctcgg ctggctctac       900
     acctggggtg cacctttgac cctgatcggc gacaacgaag accaggtcgc cgacgcccgc       960
     cgcgaactgg tccgcatcgg catcgacgac ctcgacggcg ccgcggtcgg cgaaatccac      1020
     accctcgtcg ccggcaccgc actgcggtcc taccgggtag ccgacttcgc cgccctctca      1080
     gaggcgctgc gcgagaagga catcaccgtc ctcgacgtcc ggcaacgcaa cgaatacgac      1140
     gacagccaca tcgacggggc gatcaacatt ccactccacg aactcgccga ccgacagagc      1200
     accctcccca accgcgagat ctgggtgcac tgcgcctccg gctaccgcgc ctccgtcgcc      1260
     gcctcgatga tcgaccgacc cgaccgcacc accgtgctga tcaacgacga attcgacaac      1320
     gcaaacgaca ccgacctcac cagcaccacc tag                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page