(data stored in ACNUC7421 zone)

EMBL: AP011115.PE351

AP011115.PE351       Location/Qualifiers
FT   CDS_pept        359666..360085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48598"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC1"
FT                   /protein_id="BAH48598.1"
FT                   /translation="MPESPPDRVQITDRLHVVANLLDTRDWPGFAATLTEDVVAYGRTG
FT                   PAAVVARVRSHLDVCGTTQHLLGNIRIDLDGDTARTTSYFRAFHLGLGDRAGASYECLG
FT                   EYRDQWRRGPSGWLLSGRVIDVRAEIGDRSVIAPR"
     atgcccgagt ctcctcccga ccgtgtccag atcaccgatc gcctgcacgt cgtggcaaac        60
     ctgctcgaca cgagggactg gccggggttc gccgcaaccc tcaccgagga cgtcgtggcc       120
     tacggccgca cggggcctgc ggccgtggtc gcgcgcgtgc gatcccacct cgacgtctgc       180
     ggcaccaccc agcacctgct gggcaacatc cgcatcgacc tcgacggcga cacggcccgc       240
     acgacgtcct acttccgggc atttcacctc ggcctcggcg accgagccgg cgcgtcgtac       300
     gaatgcctcg gcgaataccg ggaccagtgg cggcgcggcc cgtcgggctg gttgctgtcg       360
     gggcgcgtga tcgatgttcg cgccgaaatc ggcgaccgga gtgtcatcgc gccccgatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page