(data stored in ACNUC7421 zone)

EMBL: AP011115.PE352

AP011115.PE352       Location/Qualifiers
FT   CDS_pept        complement(360099..361187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03520"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48599"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC2"
FT                   /protein_id="BAH48599.1"
FT                   /translation="MNARMRAFGVAVTVAATVLGACAAPPPGDDAAKKVYFFLPNTTTT
FT                   RFVERDEPLFTDFLELFAPKATVTVRNAEGDPARQQSQVESAIADGAAVLVLISADARF
FT                   SGGALTAAADANVPVVLYDHDAVGGPAEVQVIFDPLEVGRRQGSRAADLIAAMPGDGLK
FT                   IARVEGNLGEYGTRQFQLGQNEYLQPLIGSRKIRVVCETAIDDWDPAEGQAFAEECLTR
FT                   ENNDVDLFVTMNDDLAGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQGTLDNTIFK
FT                   NLSDQAKVAAQLTTSILHGADLPENMINGTIDNQYMAVPTVFLPVQNITQDNLHVVVNS
FT                   GFYTWQQICAPDPDSAVCREHD"
     gtgaacgcaa ggatgcgcgc attcggtgtc gcggtcacgg tcgccgccac cgtgctcggg        60
     gcgtgcgcgg ccccgccgcc aggcgacgac gcggcgaaga aggtctactt cttcctgccg       120
     aacaccacga cgacccgctt cgtcgagcga gacgaaccct tgttcacgga cttcctcgaa       180
     ctgttcgcgc ccaaggccac cgtgacggtc cgcaacgccg agggtgatcc cgcccggcag       240
     cagagccagg tcgagtcggc gatcgcggac ggcgcggctg tgctcgtcct gatctccgcc       300
     gacgcgagat tctcgggggg agcgctgacc gccgccgccg acgcgaacgt tccggtggtg       360
     ctctacgacc acgacgcggt cggcggaccc gcggaggttc aggtgatctt cgatccgctc       420
     gaggtcggcc gacggcaggg aagtcgcgcc gcggatctga tcgcggcgat gcccggcgac       480
     ggtctgaaga tcgcccgggt agagggaaat ctcggtgaat acgggacccg ccaatttcag       540
     ctcgggcaga acgagtatct gcagccgctc atcggcagcc gcaagatccg tgtggtctgc       600
     gagaccgcga tcgacgactg ggacccggcc gagggccagg cgttcgcaga ggaatgcctg       660
     acccgggaga acaacgacgt cgatctgttc gtcaccatga acgacgatct ggcgggcgga       720
     attgtcgccg ccctggccgg ccgcgggctg gccggacgga tacccgtgac cgggggacag       780
     gacgccaatc tcgctgcgct gcaactcatc gcccagggca ccctcgacaa cacgatcttc       840
     aagaatctat ccgaccaggc gaaggtcgct gcgcagctga ccacgtcgat cctgcacggc       900
     gccgacctac ccgagaacat gatcaacggc acgatcgaca accagtacat ggcggtgccg       960
     acggtttttc tgcccgtcca gaacatcacg caggacaacc tccacgtggt ggtcaactcc      1020
     ggcttctaca cctggcagca gatctgcgca ccggatccgg actccgcggt gtgccgggaa      1080
     cacgactga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page