(data stored in ACNUC7421 zone)

EMBL: AP011115.PE353

AP011115.PE353       Location/Qualifiers
FT   CDS_pept        361226..362704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48600"
FT                   /db_xref="GOA:C1ARC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC3"
FT                   /protein_id="BAH48600.1"
FT                   /translation="MPGVGIPTGVDGYACSSMLSVFSGTDRRTLSAGMEEERVFDQDRG
FT                   TVSSGERDTSPADEHLLKESLLVEPEIRRRPWREFLESTPGRLSVLAVVLVAVALTAGV
FT                   VTSAVIGARQQRMETLRAHTEPLADAAQNLFSSLSIADAAATSSFIAGAIEPLAVRDRY
FT                   NQAIGDASNALVTASYGVTSGDVGSLRLLTEMSRHLAVYTDLVATARSNDSAGNPVGVA
FT                   YLGTASALMQDTILPLAERLYSDQAGAVADTQSHTARLPVTAIVVASAGVVVLAVAHAY
FT                   VAHRSRRRVNPGLACATVLLAALVVWIVVAGLLSTSASERARLDGAEPLAAVTKARILA
FT                   QQARADETLGLLRPGFDPTGSDYTRHTDALAAILNSDASPDAVDVPAIDDASAAFEGWR
FT                   SAHRELQRRLADGDFQGAADIAVGPGSTASTAQFRTLDESLEDAIIALRADELDAMRES
FT                   YRTMAALAVGAVVLAVSAALAVIAGIEPRVSEYH"
     gtgcctggtg tgggcatacc cacgggcgtg gacggctacg cgtgctcgtc gatgctttcg        60
     gtgttttccg gcaccgatcg gcgcacactg agtgcaggga tggaggagga gagggtgttc       120
     gaccaggacc gcggcaccgt atccagcgga gagcgtgaca cttcgccggc ggacgagcat       180
     ctcctgaaag aatccctgct cgtcgaaccg gagatccgcc gacgtccgtg gcgcgaattc       240
     ctggagtcga cgcccgggcg cctgtccgtc cttgctgtcg ttctcgtcgc ggtggcgctg       300
     acggccggtg tcgtgacatc cgcggtgatc ggcgcgcggc agcagcggat ggaaaccctt       360
     cgcgcccata ccgaaccgct ggcggacgcc gcgcagaacc tgttcagttc actgtcgatc       420
     gccgacgccg ccgcgacgtc gtcgttcatc gcgggcgcca tcgaaccgct cgcggtccgc       480
     gaccggtaca accaggcgat cggcgacgca tcgaacgcgc tcgtcaccgc gtcgtacggg       540
     gtcacctccg gtgacgtggg atcgctgcgc ctgctcaccg agatgtcgcg gcacctcgcc       600
     gtctacacgg acctggtggc aaccgcacgg tccaacgact ccgcgggaaa tccggtcggg       660
     gtggcgtacc tgggaaccgc gtcggccctg atgcaggaca ccatcctgcc gctggccgaa       720
     cggctctaca gtgatcaggc cggcgcggtc gccgacaccc agtcccacac cgcgcgactg       780
     cccgtcaccg ccatcgtggt tgcctcggca ggggtagtcg tcctcgcggt cgcgcacgcg       840
     tatgtggcgc atcggagtcg ccgtcgggtg aatccgggcc tggcgtgcgc gacggtcctg       900
     ctcgctgcgc tggtcgtgtg gatcgtggtc gcgggactgt tgtcgacgtc ggcgagcgaa       960
     cgcgcgcgcc tcgacggcgc cgaacctctc gcggcggtta cgaaggcgcg gatccttgcg      1020
     cagcaggcgc gcgctgacga gacgctcggc ctgctccggc cgggtttcga tccgacgggc      1080
     agcgactaca cccggcacac ggacgccctt gccgcgattc tgaactcgga cgcatcaccg      1140
     gacgccgtcg acgtgccggc catcgacgat gcttccgctg ccttcgaggg atggcggagt      1200
     gcgcatcggg aactgcagcg caggcttgcc gacggcgact tccagggcgc ggcggacatc      1260
     gcggtcggcc cgggatcgac ggcgtcgacg gcccagttcc ggactctcga cgaatcgctc      1320
     gaagacgcca tcatcgcgct gcgtgccgac gaactcgacg cgatgcgtga gtcgtaccgg      1380
     acgatggcgg cgctcgccgt gggcgccgtc gtgctcgccg tttccgcggc gctggccgtg      1440
     atcgcgggta tcgaacccag agtgagtgag tatcactga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page