(data stored in ACNUC7421 zone)

EMBL: AP011115.PE354

AP011115.PE354       Location/Qualifiers
FT   CDS_pept        362704..363693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03540"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48601"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC4"
FT                   /protein_id="BAH48601.1"
FT                   /translation="MVRPFRARRPGITRLLGGLAFGTVLIAGCGSPDAPTPMFSGDFTE
FT                   FPASVGARIIEPSESPPPDGQPSSCAPTVSLRPGIAGAGGALGEIRARGSLVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPAKVEFRPLGSGDGAEMLAHRDADMIVR
FT                   PVALPCESPQDVAFSTVYLETPRRLVVRVGSGISEPADLARRRVCTHDDPASVSALSRI
FT                   APKATIVAVPDWDDCLMAIQQRQVDAVVGAALLAGLVAQDPNLDIVGPDSDSARYAIAL
FT                   APGRDDLVRFVNGTLERLRTDGTWTALYDRWLSPLGPAPAPPSPDYRD"
     atggtgcgac ctttccgcgc acggcgaccg gggatcactc ggctgctcgg cggcctcgcg        60
     ttcggaactg tgctgatcgc cggctgcggg tcacccgacg cacccacccc gatgttctcc       120
     ggagacttca cggagtttcc cgcgtcggtc ggcgcgcgca tcatcgaacc gtccgaatcg       180
     ccgccgcccg acgggcagcc gtcgtcctgc gcacccacgg tgagcctccg tccggggatc       240
     gccggcgccg gcggcgctct cggcgagatc cgggcccgcg gaagcctggt cgtcgcagtc       300
     gatcagaaca ccaacctgtt cagcttccgc gatccgacca ccggcaccct caccggcttc       360
     ggcgtcgacc tcgcgaggga ggtcgcccgc gacctgctcg gcgaccccgc caaggtcgaa       420
     ttccggccac tcggttccgg cgacggcgcc gagatgctcg cgcaccggga cgcggacatg       480
     atcgtgcgac cggtggcact gccctgcgag agtccgcagg atgtggcctt ctccacggtg       540
     tatctcgaga caccccgtcg gctcgtcgtg cgagtcgggt ccggcatatc cgagcccgcg       600
     gacctggcgc ggcgacgggt ctgcacgcac gacgatccgg cgtcggtgtc ggcgctgtcg       660
     cgcatcgccc cgaaagccac gatcgttgcg gtacccgact gggacgattg cctcatggcc       720
     atccagcaac ggcaggtcga cgcggtcgtg ggtgcggctc tcctcgccgg actcgtcgcc       780
     caggatccga atctcgacat cgtcggtccc gactccgatt ccgcccggta cgccatcgcc       840
     ctcgcgcccg gccgtgacga cctcgtccgt ttcgtcaacg gcaccttgga gcgactgcgc       900
     accgacggaa cctggactgc cctctacgat cgctggctgt cgccgctcgg cccggcaccc       960
     gcgccgccgt ccccggacta ccgggactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page