(data stored in ACNUC7421 zone)

EMBL: AP011115.PE355

AP011115.PE355       Location/Qualifiers
FT   CDS_pept        complement(363713..364126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48602"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC5"
FT                   /protein_id="BAH48602.1"
FT                   /translation="MELVERAVSADIDAAARAVITAAAAEASRHADEIIGTGPLPGTAE
FT                   WDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTRQS
FT                   AHERWGARTTALLDPMGTGLPQTVADDDPEVAR"
     atggaacttg tcgaacgtgc cgtcagtgcc gacatcgacg ccgctgcgcg cgcggtgatc        60
     acggccgcgg cagccgaagc gagccgtcat gccgacgaaa tcatcggcac cgggccgctt       120
     cccggcactg cggaatggga tgccgagcag ggcacggaca ttcctaacca gcgcaccctg       180
     gcctggcatc tgctgagcct tcgcatccag ctggccgccg gcctggacgg tatcgaaacc       240
     gttctcgggc tgcgctttca gggcgccacc tgggcaacga tcggaaaggc cgccggaatg       300
     acccggcagt cggcgcacga gcggtggggt gcccgcacga ccgccctgct cgacccgatg       360
     gggaccggcc ttccgcagac cgttgccgac gatgatcccg aggtcgcccg gtaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page