(data stored in ACNUC7421 zone)

EMBL: AP011115.PE357

AP011115.PE357       Location/Qualifiers
FT   CDS_pept        complement(365051..365494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03570"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48604"
FT                   /db_xref="GOA:C1ARC7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC7"
FT                   /protein_id="BAH48604.1"
FT                   /translation="MTSTPPATGAFDATPAPTDGTTKKARVAGLVVSALAVLFLLFDSL
FT                   IHIANTQMVREAMAELGFAENLNRVIGVVLLVCLILYIVPATSILGAVLLTGYLGGAVA
FT                   TNLLTEQPIVSTTLFPIYVGVFVWGGLYLRDPMVRSIMPVRRT"
     atgacctcga cacctcccgc caccggcgca ttcgacgcga cacccgcgcc cacggacgga        60
     acgacgaaga aggcccgagt cgcagggctc gtcgtcagcg cactcgcggt gctgtttctc       120
     ctgttcgact cgctcatcca catcgcgaac acccagatgg tgcgtgaagc gatggccgaa       180
     ctgggcttcg ccgagaacct caaccgcgtc atcggggtgg tactgctggt gtgcctgatt       240
     ctctacatcg tgcccgccac ctcgatcctg ggtgcggtgc tgctcaccgg atacctcggt       300
     ggagcggtcg ccaccaacct gctcaccgag cagccgattg tcagcaccac actgttcccg       360
     atctacgtcg gcgtcttcgt gtggggtggg ctgtacctcc gcgacccgat ggtgcgctcg       420
     atcatgcccg ttcgacgcac ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page