(data stored in ACNUC7421 zone)

EMBL: AP011115.PE358

AP011115.PE358       Location/Qualifiers
FT   CDS_pept        365700..366161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC8"
FT                   /protein_id="BAH48605.1"
FT                   /translation="MDGLVKLVIEATDLPGSSCPPGANFPGYDNIHVAVQRRGTPGDLL
FT                   DLHPGDATTARWVLECGTTPTPTGLDITGPYIQGRPGARFVYLSWGTVDGDGGFDMFRR
FT                   AKLMWDAVDPATANAAASAGRITARLGLTDARGNPLCAAVRPPLVEWSA"
     ttggatgggc tggtgaagct cgtgatcgaa gcgaccgacc ttcccggatc gtcgtgcccg        60
     ccaggagcca atttccccgg ctacgacaac atccatgtgg ctgtgcagcg ccgcggcact       120
     cccggcgatc tgctcgacct gcatccgggc gacgcgacca ccgcccgctg ggttctcgaa       180
     tgcgggacga ccccgacgcc gacgggtctc gacatcaccg ggccgtacat ccagggccgt       240
     cccggtgcgc ggttcgtcta cctgtcgtgg ggaacagtcg acggagacgg tggattcgac       300
     atgttccgcc gggcgaagtt gatgtgggac gcggtggatc cggccaccgc gaatgcggcg       360
     gcgtcggccg ggcgcatcac cgcgcgactc ggactcaccg atgcccgggg caatcccctg       420
     tgcgctgcgg tgcgtccgcc gttggtcgag tggtctgcct ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page