(data stored in ACNUC7421 zone)

EMBL: AP011115.PE359

AP011115.PE359       Location/Qualifiers
FT   CDS_pept        complement(366234..367667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03590"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48606"
FT                   /db_xref="GOA:C1ARC9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC9"
FT                   /protein_id="BAH48606.1"
FT                   /translation="MTGRTANARRMSLRTLLWLAIGILVALFAVSAAFSVYGRLVVRAS
FT                   EDVLSERLLPAQRAVSDLTTAYVDQETGQRGYVLTGDPRFLEPYDAGRSAAAASLSDLT
FT                   ALLGGDAEASATLDAVVEAANTWTSQASEPEITARRNDAIAQDQVVAMTATGKELFDGL
FT                   RSELQELNSLTDERVTEQVDRVRSAQILANVATAVAFVLAVGTAIISGYLTRRLLTQPI
FT                   ERLVADISAVAEGDYERKIGTDGPREVSMIGGAVDTMRNSLLTQNRLLVQAEHERTRHD
FT                   EQTRMAADLHDLTIQRVFGLGLALTSVARRHPRLTADLDPLIDETDSIVRGLRAVIFDL
FT                   QMGSASLTNGTASLSAAVGEIVESSTAALGFTPDVCLDGPVDLFSGHDAGPELQAVLRE
FT                   ALSNVARHAHATSCRVMVAADDDRLTLSVTDDGTGIGEDAVRGHGLANICNRAAQLGGR
FT                   AVIRDGAPGTVVEWEVPAS"
     atgacgggtc ggactgcgaa tgccagacgg atgtcgttgc ggacattgct gtggctggcg        60
     atcgggatcc tcgtggccct gttcgctgtt tccgccgcgt tctccgtgta cgggaggctg       120
     gtggttcggg catccgagga cgtgctctcc gagcgtctcc tgcccgcgca gcgtgccgtg       180
     tcggatctga cgaccgccta tgtggaccag gagaccgggc agcgtggata cgtgctgacc       240
     ggtgatccga ggttcctcga accgtacgac gcaggccggt ccgctgctgc cgcgtccctg       300
     tcggacctga ccgcgctgct cggcggcgac gccgaggctt ccgcgacgct ggacgcggtc       360
     gtcgaggcgg cgaacacgtg gaccagtcag gccagcgagc cggagatcac cgctcgtcgg       420
     aacgacgcga tagcgcaaga tcaggtcgtg gcgatgaccg ccacgggcaa ggaactgttc       480
     gacgggctgc gctcggagct ccaggaactc aactccctga cggatgaacg ggtgaccgaa       540
     caggtggatc gggtccgctc ggcgcagatc ctggcgaacg tcgcgaccgc cgtcgcgttc       600
     gttctcgccg tcggcacggc gattatttcc gggtacctga cgcgacggtt gctgacccag       660
     ccgatcgaac gcctcgtcgc cgatatcagt gcggtggccg aaggcgacta cgaacgaaag       720
     atcggcaccg acgggccgag ggaagtgtcg atgatcggcg gggccgtcga cacgatgagg       780
     aacagtctgc tgacccagaa tcggctactc gtgcaggccg aacacgaacg aacccgccac       840
     gacgaacaga cccggatggc ggcagatctg catgacctga cgattcagcg cgtgttcggg       900
     ctcggcctgg cattgacctc cgtggcccga cggcatcccc gtctcaccgc ggatctcgat       960
     ccgctgatcg acgaaaccga cagcatcgtt cgcggtttgc gggcggtcat cttcgacctt      1020
     cagatgggct ctgcctcgtt gacgaacggc accgcgagtt tgagtgcggc ggtcggtgag      1080
     atcgtcgaga gcagcaccgc cgcgctcggt ttcactcccg acgtgtgcct ggacgggccg      1140
     gtcgacctgt tctccggaca cgacgccggc ccggaacttc aggcagtgct ccgcgaggca      1200
     ctgagcaacg tcgcccggca cgcccacgcg acatcgtgcc gcgtcatggt tgccgctgat      1260
     gacgaccgtc tgacgctgag cgtgaccgac gacggtaccg gtatcggcga ggacgccgtc      1320
     cgagggcacg ggctggcaaa tatctgcaac cgggccgcgc aactcggcgg tcgtgccgtc      1380
     atccgggacg gcgctccggg gacggtcgtc gagtgggaag tgcccgcgtc ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page