(data stored in ACNUC7421 zone)

EMBL: AP011115.PE36

AP011115.PE36        Location/Qualifiers
FT   CDS_pept        complement(30731..31504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48283"
FT                   /db_xref="GOA:C1AS34"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS34"
FT                   /protein_id="BAH48283.1"
FT                   /translation="MTLTVALALGAIIGVLLGLLGGGGSILAVPALVFGLGLGLEEAIP
FT                   ISLIVIGVASLVGAIPKIREHQVNWRMAGVFAACGIPATFAGSAVGRLLPQPVVMIGFA
FT                   AVMIVAGIRMLMDRGDTGTACEVGDSGIDWRRCAPRSIPAAALVGFLTGLFGVGGGFLI
FT                   IPALVLMLGLEMPVAIGTSLVIIVANSAAGLISHLSGASIDWAITAAFAGTAIAGSLIA
FT                   SHFGTRVDTDRLQRWFAYLVFVVAAYVLVDTILLR"
     gtgactctga ccgtcgcgct cgccctcgga gcgatcatcg gcgtgctgct cggactcctc        60
     ggcggcggcg gatcaattct ggcggtcccg gccctggtct tcggcctcgg actgggcctc       120
     gaggaggcca tcccgatctc cctgatcgtc atcggtgtcg cctccctcgt cggagccatc       180
     ccgaaaattc gggaacacca ggtgaattgg cgcatggccg gggtattcgc cgcctgcggc       240
     attcccgcca ccttcgccgg cagcgcggtc gggcgcctgc tgccgcaacc ggtggtcatg       300
     atcggtttcg ccgcggtgat gatcgtcgcc gggatccgga tgctgatgga tcgtggtgac       360
     accggcaccg cctgcgaggt cggggactcg gggatcgact ggcgccgctg cgccccccga       420
     tccatccccg ccgcggccct ggtgggcttt ctgaccggcc tgttcggtgt cggcggcggc       480
     ttcctgatca tccccgcact ggtgctgatg ctcggcctcg agatgccggt cgcgatcggc       540
     acctccctgg tcatcatcgt cgcgaactcc gcggccggtc tcatctcaca cctgagcggc       600
     gcgagcatcg actgggcgat caccgccgcg ttcgccggca ccgcgatcgc cgggtccctg       660
     atcgccagtc atttcggcac cagggtcgac accgaccggc tgcaacggtg gttcgcttat       720
     ctcgtcttcg tcgtcgccgc atatgtgctg gtcgacacga tccttctccg ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page