(data stored in ACNUC7421 zone)

EMBL: AP011115.PE360

AP011115.PE360       Location/Qualifiers
FT   CDS_pept        complement(367798..368220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48607"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD0"
FT                   /protein_id="BAH48607.1"
FT                   /translation="MGTGGRAARVEDVHESALGMPHVTVTYGPADNPVYQVGGKSFVFF
FT                   RTPRPDATDPDTGERYDDVIVFWVPSDADKQALVRDHTTPFFTTSHFDGHLSVLLRGSR
FT                   VGELSRHELVELVQDAWLSRASARRAATWLSAHPPA"
     atgggaaccg gtgggcgggc ggcacgggtc gaggacgtgc acgaatcggc tctcggcatg        60
     cctcacgtca ccgtcaccta cggccccgcc gacaaccccg tctaccaggt cggcggtaag       120
     tcgttcgtat tcttccgcac gccccggccc gatgcgacgg accccgacac cggggaacgc       180
     tatgacgacg tgatcgtgtt ctgggtgccg tccgatgccg acaagcaggc tctcgttcga       240
     gatcacacga caccgttctt caccacctcg cacttcgacg gccacctgtc ggtgctgttg       300
     cgggggagcc gcgtcggcga gttgtcccgg cacgaattgg tggaactcgt tcaggacgcg       360
     tggctctctc gcgcatccgc gcgtagagca gcgacctggc tcagcgcgca cccaccagcc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page