(data stored in ACNUC7421 zone)

EMBL: AP011115.PE361

AP011115.PE361       Location/Qualifiers
FT   CDS_pept        complement(368345..368800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48608"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD1"
FT                   /protein_id="BAH48608.1"
FT                   /translation="MNSIMTLSDLTALTGLDVFDYLDQEVLVPVVDGMQAQGDLIVIPY
FT                   SIVAELVTPNHWTRSENVPLSGVELLRSAAGGNPHSLVADEGMCTWSTPVDDPRRLALG
FT                   ILDTRVTAYLIHPEHGATGIAPGRYVVGRQRERSVGRSFERTQFVVD"
     atgaactcga tcatgaccct gtccgatctc acggccctca ccggcctcga cgtcttcgac        60
     tatctcgacc aggaggtgtt ggtacccgtc gtcgacggta tgcaggccca gggtgatctc       120
     atcgtgatcc cgtattcgat tgtcgccgag ctcgtcacgc ccaatcactg gacgcggtcg       180
     gagaacgtac cgctgtcggg agtggagctg ctgcgcagcg cggccggtgg aaatccgcac       240
     agtctcgtcg ccgacgaggg gatgtgcacg tggtcgacac ccgtcgacga cccgcggcgc       300
     ctcgcgctcg gcatcctcga cacccgcgtt accgcctacc tcattcaccc cgagcacgga       360
     gccaccggca tcgcccccgg tcgatacgtc gtcggacgac agcgggaacg gagcgtgggg       420
     cggtccttcg agcggacaca gttcgtcgtc gattga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page