(data stored in ACNUC7421 zone)

EMBL: AP011115.PE362

AP011115.PE362       Location/Qualifiers
FT   CDS_pept        complement(368834..370066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48609"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD2"
FT                   /protein_id="BAH48609.1"
FT                   /translation="MSATPRRSKARHRATFIDNTDHSAEYMFGVGAVRDAWLGHGLCAR
FT                   PSDRAAAESAVETLYRRAGFRDPEFVWVPSPPAGSDLIAAEGLATTLSFAGDGADCVSA
FT                   RMATMLSESRKRMDALIARGRSDWPNERRAIEIARAQPPDHSARVGISPNAIIRAAVWD
FT                   SLRTTLFDGVAAAIRTLMPAAVGGVSWYGQQEAHRVAYYDTYRRFGLARFHSVDAELLD
FT                   VHTALTGATGWWWAFDSTCVMAERPIALHAEPIPGRVHNEHRLHHLDAPALEFGDGRSL
FT                   FVQNGTIVPDWVVLEPTVERIAGERNVEVRRCAIERIGWDTYIDSAGLALIGRVDDPGN
FT                   IGHTLQLYATSDGRGRIEHILLAVNGSPERDGRRRRYGIYVPTRISSALDAAAWTYGLD
FT                   GADYARLVRRT"
     gtgagcgcca cgccacgtcg ctcgaaggct cgacaccgag cgacattcat cgataacacc        60
     gatcactccg ccgaatacat gttcggtgtc ggagctgtgc gtgacgcatg gctcgggcac       120
     ggattgtgtg cacgcccgtc agaccgcgcc gcggccgaat cggccgtcga aacactctat       180
     cggcgagcag gattccgaga tccggagttc gtgtgggtgc cgtcgccccc ggccggatcg       240
     gacctgatcg ccgccgaggg gttggcgacg acgctgtcgt tcgccggcga cggagccgac       300
     tgcgtatccg cccgaatggc aaccatgctc tcggaatcgc gcaaacgtat ggatgccctg       360
     atcgcccggg ggagatccga ctggccgaac gaacgccggg cgatcgaaat cgcacgtgcc       420
     cagccgcccg accactctgc ccgcgtcggc atcagcccca acgccatcat ccgagccgct       480
     gtctgggact ctttgcgcac gacccttttc gacggcgtcg cggctgcgat acgaacgctg       540
     atgcccgccg ccgtcggcgg cgtgagctgg tacggacagc aagaagcgca tcgggtcgcg       600
     tactacgaca cgtaccgtcg gttcgggctc gccaggttcc actccgtcga tgccgagctg       660
     ctcgacgtcc atacggcgct gaccggcgcg accgggtggt ggtgggcgtt cgacagcacc       720
     tgcgtcatgg cggagcgtcc catcgccctt catgccgagc ccataccggg ccgtgtccac       780
     aacgagcacc ggttgcatca cctggatgcg cctgcgctcg aattcgggga cggtcgatcg       840
     cttttcgtgc agaacgggac gatcgtcccc gactgggtcg tcctcgagcc gaccgtcgaa       900
     cgcatcgccg gcgaacgtaa cgtggaggtc cgccgatgcg cgatcgagcg catcggatgg       960
     gacacctaca tcgactcggc cggactcgcg ttgatcggcc gcgtcgacga tcccggcaac      1020
     atcggtcaca cgctgcagct gtacgcaact tcggacggcc ggggccgcat cgagcatatc      1080
     ctgctcgccg tcaacggttc tcccgaacgc gacggccgtc ggcgacgata cggaatctat      1140
     gtgcccacgc ggatttcgtc cgcgttggac gccgcagcgt ggacctacgg cctcgacggc      1200
     gccgactacg cccgtctcgt tcgccgaacc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page