(data stored in ACNUC7421 zone)

EMBL: AP011115.PE363

AP011115.PE363       Location/Qualifiers
FT   CDS_pept        370305..371009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48610"
FT                   /db_xref="GOA:C1ARD3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD3"
FT                   /protein_id="BAH48610.1"
FT                   /translation="MTSSNYSAPPNDGSRHRTGPADALKGELPVTDSVLSYTDHGRTDE
FT                   MTLIPDRSPIVIGRSAYADLSLPTDPDISRLHATIERIGIHWTITDDGLSRNGTFVNGT
FT                   RLQGRQTLHPGDVIQVGESLLTYHGEPGTDCGITHIGDTVDPDIVLTPAQHTVLTELCR
FT                   PFHDGTDHPIPASNRQIADALHLSTETVKTHLRALFSTFHIEDLPQNQKRSRLVTLALT
FT                   NGVLDAAAPSDF"
     atgacgtcga gcaactacag cgccccgccg aacgacggat ctcggcatcg caccggtccc        60
     gccgacgctc tgaaagggga actcccggtg acggactccg tcctgtcgta caccgaccac       120
     gggcggaccg acgagatgac cctcatcccg gaccgctccc cgatcgtcat cggccgctcc       180
     gcttacgccg acctgtcact gcccaccgac ccggacatct cgcgcctgca cgccaccatc       240
     gaacgcatcg gcatccactg gaccatcacc gacgacggcc tctcccgcaa cggcaccttc       300
     gtgaacggca cccgcctgca agggcgtcag acccttcacc ccggagacgt catccaggtc       360
     ggcgagagcc tcctcaccta ccacggggag ccgggcacgg actgcggcat cacccacatc       420
     ggggacaccg tggatccgga catcgttctc acacctgccc agcacaccgt cctcacggag       480
     ctgtgccggc cgttccacga cggcaccgac caccccatcc cggcctcgaa tcgccagatt       540
     gccgatgccc tgcatttgag tactgaaacc gtcaagaccc atctccgtgc tctcttcagc       600
     acattccaca tcgaggacct ccctcagaat cagaaacgtt cgcgactcgt cactctcgcc       660
     ctcaccaatg gcgtcctcga cgcggctgct cccagcgact tctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page